SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000018262 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000018262
Domain Number 1 Region: 56-144
Classification Level Classification E-value
Superfamily EF-hand 8.44e-25
Family S100 proteins 0.0000657
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000018262   Gene: ENSPANG00000009566   Transcript: ENSPANT00000019655
Sequence length 147
Comment pep:known_by_projection chromosome:PapAnu2.0:1:127419536:127423952:1 gene:ENSPANG00000009566 transcript:ENSPANT00000019655 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEPQTKTPSAELPPYPGQPAQSAAAPAATFAASAICPEPAPTSGPGRRCTAAMGSELET
AMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDVDAVDKVMKELDENGD
GEVDFQEYVVLVAALTVACNNFFWENS
Download sequence
Identical sequences A0A096NYU6
ENSPANP00000018262

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]