SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000018302 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000018302
Domain Number 1 Region: 235-552
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 2.38e-88
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000516
Further Details:      
 
Domain Number 2 Region: 103-222
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.99e-24
Family Anticodon-binding domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000018302   Gene: ENSPANG00000019006   Transcript: ENSPANT00000005082
Sequence length 558
Comment pep:known_by_projection chromosome:PapAnu2.0:18:49809038:49834362:-1 gene:ENSPANG00000019006 transcript:ENSPANT00000005082 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLEVTRATAGMVLELYVSDREGSDATGDGTKEKPFKTGLKALMTVGKEPFPTIYVDSQK
ENERWNVISKSQLKNIKKMWHREQMKTESREKKEAEDSLRREKNLEEAKKITIKNDPALP
EPKCVKISALGGYRGQRVKVFGWVHRLRRQGKNLMFLVLRDGTGYLQCVLADELCQCYNG
VLLSTESSVAVYGMLNLTPKGKQAPGGHELSCDFWELIGLAPAGGADNLINEESDVDVQL
NNRHMMIRGENMSKILKARSMITRCFRDHFFDRGYHEVTPPSLVQTQVEGGATLFKLDYF
GEEAFLTQSSQLYLETCLPALGDVFCVAQSYRAEQSRTRRHLAEYTHVEAECPFLTFDDL
LNRLEDLVCDVVDRILKSPAGSIVYELNPNFQPPKRPFKRMNYSDAIIWLKEHDIKKEDG
TFYEFGEDIPEAPERLMTDTINEPILLCRFPVEIKSFYMQRCPEDSRLTESVDVLMPNVG
EIVGGSMRSSDAEEILAGYKREGIDPAPYYWYTDQRKYGTCPHGGYGLGLERFLTWILNR
YHIRDVCLYPRFVQRCTP
Download sequence
Identical sequences A0A096NYY6
ENSPANP00000018302

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]