SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000018315 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000018315
Domain Number 1 Region: 24-147
Classification Level Classification E-value
Superfamily PX domain 9.29e-34
Family PX domain 0.0000683
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000018315   Gene: ENSPANG00000017995   Transcript: ENSPANT00000011030
Sequence length 162
Comment pep:known chromosome:PapAnu2.0:4:153942666:153993428:1 gene:ENSPANG00000017995 transcript:ENSPANT00000011030 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAETVADTRRLITKPQNLNDAYGPPSNFLEIDVSNPQTVGVGRGRFTTYEIRVKTNLPIF
KLKESTVRRRYSDFEWLRSELERESKVVVPPLPGKAFLRQLPFRGDDGIFDDNFIEERKQ
GLEQFINKVAGHPLAQNERCLHMFLQDEIIDKSYTPSKIRHA
Download sequence
Identical sequences A0A0D9RRL9 A0A1A6FYQ3 A0A1U7QG80 A0A1U7UB23 A0A250YAL5 A0A2J8SFV3 A0A2K5DLK8 A0A2K5J9B3 A0A2K5L9Y4 A0A2K5PYJ6 A0A2K5X3J0 A0A2K6B5I6 A0A2K6FTW9 A0A2K6QHJ0 A0A2K6TXE1 B0CM46 B0KWH6 B1MTJ8 B2KI93 B3RF25 B5FW39 B7NZG7 C1FXW7 D2H6J3 F1RT25 F6UT62 F6VUD7 F6W8H1 H2QTI3 I3M9D9 K9IG36 L5JNU7 L8IEN8 M3YEI1 O60493 Q1RMH8 Q5R5V1 Q5U211 Q78ZM0 U6CN15 W5PMB1
ENSVPAP00000000751 ENSBTAP00000025026 ENSMUSP00000019939 ENSMICP00000013022 ENSSTOP00000006492 ENSAMEP00000008567 ENSMUSP00000019939 ENSMMUP00000026798 ENSP00000230085 ENSBTAP00000025026 10090.ENSMUSP00000019939 9544.ENSMMUP00000026798 9598.ENSPTRP00000031552 9600.ENSPPYP00000018915 9606.ENSP00000230085 9796.ENSECAP00000020162 9913.ENSBTAP00000025026 9986.ENSOCUP00000005073 NP_001037748.1.100692 NP_001037748.1.4139 NP_001073246.1.59421 NP_001073246.1.76553 NP_001126677.1.23681 NP_001164795.1.1745 NP_001244882.1.72884 NP_003786.1.87134 NP_003786.1.92137 NP_059500.2.92730 XP_001149032.1.37143 XP_001504033.1.31192 XP_002917385.1.58354 XP_003824375.1.60992 XP_003935989.1.74449 XP_004011275.1.66739 XP_004264798.1.21590 XP_004318370.1.83887 XP_004397965.1.74151 XP_004422242.1.5094 XP_004468474.1.11602 XP_004605764.1.94378 XP_004660670.1.11716 XP_004673806.1.23501 XP_004753513.1.14098 XP_005073275.1.91757 XP_005330198.1.77405 XP_005363633.1.66349 XP_005551583.1.63531 XP_005898250.1.15283 XP_005964446.1.78601 XP_006075411.1.26621 XP_006101760.1.53796 XP_006205693.1.17985 XP_006926115.1.64745 XP_006982826.1.50099 XP_007119118.1.24612 XP_007190720.1.59432 XP_008005602.1.81039 XP_008063081.1.4292 XP_008154638.1.99482 XP_008518883.1.77740 XP_008848539.1.79516 XP_010380795.1.97406 XP_010854948.1.44457 XP_010963690.1.22495 XP_010987911.1.51371 XP_011358989.1.92234 XP_011757172.1.29376 XP_011808216.1.43180 XP_011905799.1.92194 XP_011994448.1.54773 XP_012293863.1.9421 XP_012506645.1.63892 XP_012608574.1.48125 XP_014694528.1.49734 XP_015355402.1.40921 XP_016015682.1.101085 XP_016811569.1.37143 XP_017399219.1.71028 XP_017908587.1.57651 XP_019298573.1.44245 XP_019514553.1.44202 XP_019822822.1.53367 XP_020020140.1.5219 XP_020946444.1.46622 XP_021060616.1.100879 XP_021548812.1.83697 XP_855006.2.84170 ENSAMEP00000008567 ENSPVAP00000001070 ENSMPUP00000009738 ENSP00000230085 ENSMPUP00000009738 ENSECAP00000020162 ENSECAP00000020162 ENSTTRP00000008405 ENSPTRP00000031552 ENSPTRP00000031552 hss001000787.1 mmk001006096.1 ENSMMUP00000026798 ENSPPYP00000018915 ENSTTRP00000008405 gi|4507143|ref|NP_003786.1| ENSP00000230085 ENSMICP00000013022 ENSDNOP00000022918 ENSOCUP00000005073 ENSCAFP00000005620 ENSOARP00000011586 ENSMUSP00000019939 ENSVPAP00000000751 ENSPVAP00000001070 ENSOCUP00000005073 ENSGGOP00000028000 ENSGGOP00000011600 ENSPANP00000018315 ENSPPYP00000018915 ENSSTOP00000006492 ENSCAFP00000005620

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]