SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000018365 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000018365
Domain Number 1 Region: 386-611
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.44e-35
Family Calponin-homology domain, CH-domain 0.00039
Further Details:      
 
Domain Number 2 Region: 85-242,380-462
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.86e-22
Family FAD/NAD-linked reductases, N-terminal and central domains 0.061
Further Details:      
 
Domain Number 3 Region: 722-753
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000499
Family LIM domain 0.00059
Further Details:      
 
Domain Number 4 Region: 688-721
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000108
Family LIM domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000018365   Gene: ENSPANG00000014435   Transcript: ENSPANT00000011001
Sequence length 1065
Comment pep:known_by_projection chromosome:PapAnu2.0:4:152774235:152784418:1 gene:ENSPANG00000014435 transcript:ENSPANT00000011001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASPTSTNPAHAHFESFLQAQLCQDVLSSFQELCGALGLEPGGGLPQYHKIKDQLNYWSA
KSLWTKLDKRAGQAVYQQGRACTSTKCLVVGAGPCGLRVAVELALLGARVVLVEKRTKFS
RHNVLHLWPFTIHDLRALGAKKFYGRFCTGTLDHISIRQLQLLLLKVVLLLGVEIHWGVT
FTGLQPPPRKGSGWRAQLQPNPPAQLANYEFDVLISAAGGKFVPEGFKVREMRGKLAIGI
TANFVNGRTVEETQVPEISGVARIYNQSFFQSLLKATGIDLENIVYYKDDTHYFVMTAKK
QCLLRLGVLRQDWPDTDRLLGSANVVPEALQRFARAAADFATHGKLGKLEFAQDAHRQPD
VCAFDFTSMMRAESSARVQEKHGARLLLALVGDCLVEPFWPLGTGVARGFLAAFDAAWMV
KRWAEGAEPLEVLAERESLYQLLSQTSPENMHRNVAQYGLDPATRYPNLNLRAVTPNQVR
DLYDVLTKEPVQRNDKTDARMPTTGSAGTQEELLRWCQEQTAGYPGVHVSDLSSSWTDGL
ALCALVHRLQPGLLEPSELQGLGALEATAWALKVAEHELGITPVVSAQAVVAGSDPLGLI
AYLSHFHSAFKSTAHSPGPVSQASPGTSSAVLFLGKLQRTLQRSRAKENAEDAGGKKLRL
EMDAETPSTEVPPDPEPGVPLTPPSQHQEAGAGDLCALCGEHLYVLERLCVDGHFFHRSC
FRCHTCEATLWPGGYEQHPGDGRFYCLQHLPQPDHKEEGSDGGPESPELPTPSENSMPPD
LSTPTASQEGVGPVPDPSQPTRRRIHLSSLERQRLSSLNLTPDPEMEPPPKPPRSCSALA
RHALESSFVGWGLPAQSPQALAAMEKEEEESSSSSEEEEDVPLDSDVEQALQTFAKTSGT
MNDYPTWRRTLLRRAKEEEMKRFRKAQTIQRRLNEIEGALRELEAEGVKLELALRRQSSS
PEQQKKLWVGQLLQLVDKKNSLVAEEAELMIMVQELNLEEKQWQLDQELRGYMNREETLK
TAADRQAEDQVLRKLVDLVNQRDALIRLQEERRLSELALGIGAQG
Download sequence
Identical sequences ENSPANP00000018365

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]