SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000018367 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000018367
Domain Number 1 Region: 483-650
Classification Level Classification E-value
Superfamily Mitochondrial carrier 9.68e-46
Family Mitochondrial carrier 0.00075
Further Details:      
 
Domain Number 2 Region: 328-439
Classification Level Classification E-value
Superfamily Mitochondrial carrier 1.44e-27
Family Mitochondrial carrier 0.00083
Further Details:      
 
Domain Number 3 Region: 11-158
Classification Level Classification E-value
Superfamily EF-hand 1.48e-19
Family Calbindin D9K 0.074
Further Details:      
 
Domain Number 4 Region: 159-289
Classification Level Classification E-value
Superfamily EF-hand 0.0000000436
Family Calmodulin-like 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000018367   Gene: ENSPANG00000000583   Transcript: ENSPANT00000012277
Sequence length 722
Comment pep:known_by_projection chromosome:PapAnu2.0:3:105687340:105885593:1 gene:ENSPANG00000000583 transcript:ENSPANT00000012277 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAKVALTKRADPAELRTIFLKYASIEKNGEFFMSPNDFVTRYLNIFGESQPNPKTVEL
LSGVVDQTKDGLISFQEFVAFESVLCAPDALFMVAFQLFDKAGKGEVTFEDVKQVFGQTT
IHQHIPFNWDSEFVQLHFGKERKRHLTYAEFTQFLLEIQLEHAKQAFVQRDNARTGRVTA
IDFRDIMVTIRPHVLTPFVEECLVAAAGGTTSHQVSFSYFNGFNSLLNNMELIRKIYSTL
AGNRKDVEVTKEEFVLAAQKFGQVTPMEVDILFRLADLYEPRGRMTLADIERIAPLEEGT
LPFNLAEAQRQKASGDSARPVLLQVAESAYRFGLGSVAGAVGATAVYPIDLVKTRMQNQR
STGSFVGELMYKNSFDCFKKVLRYEGFFGLYRGLLPQLLGVAPEKAIKLTVNDFVRDKFM
HKDGSVPLAAEILAGGCASSQGTDDAQTSTAPKLCLPALLLLRSRTDHLQNTACSSRQHP
GPSMAGGSQVIFTNPLEIVKIRLQVAGEITTGPRVSALSVVRDLGFFGIYKGAKACFLRD
IPFSAIYFPCYAHVKASFANEDGQVSPGSLLLAGAIAGMPAASLVTPADVIKTRLQVAAR
AGQTTYSGVIDCFKKILREEGPKALWKGAGARVFRSSPQFGVTLLTYELLQRWFYIDFGG
VKPMGSEPVPKSRINLPAPNPDHVGGYKLAVATFAGIENKFGLYLPLFKPSVPTSEAIGG
GP
Download sequence
Identical sequences ENSPANP00000018367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]