SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000018412 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000018412
Domain Number 1 Region: 1075-1230,1269-1348
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.82e-40
Family Voltage-gated potassium channels 0.024
Further Details:      
 
Domain Number 2 Region: 1398-1595,1623-1648
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.26e-39
Family Voltage-gated potassium channels 0.021
Further Details:      
 
Domain Number 3 Region: 626-773,807-854
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.73e-31
Family Voltage-gated potassium channels 0.019
Further Details:      
 
Domain Number 4 Region: 2-141,230-299
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.22e-29
Family Voltage-gated potassium channels 0.017
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000018412
Domain Number - Region: 1657-1702
Classification Level Classification E-value
Superfamily EF-hand 0.0424
Family Calmodulin-like 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000018412   Gene: ENSPANG00000000722   Transcript: ENSPANT00000023924
Sequence length 1866
Comment pep:known_by_projection chromosome:PapAnu2.0:12:27934705:28001616:-1 gene:ENSPANG00000000722 transcript:ENSPANT00000023924 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLIMCTILTNCVFMTMSNPPDWTKNVEYTFTGIYTFESLIKIIARGFCLEDFTFLRDPWN
WLDFTVITFAYVTEFVDLGNVSALRTFRVLRALKTISVIPGLKTIVGALIQSVKKLSDVM
ILTVFCLSVFALIGLQLFMGNLRNKCIQWPPTNASLEEHSVEKNITVNYNGTLINETVFE
FDWKSYIQDSRYHYFLEGFLDALLCGNSSDAGQCPEGYVCVKAGRNPNYGYTSFDTFSWA
FLSLFRLMTQDFWENLYQLTLRAAGKTYMIFFVLVIFLGSFYLINLILAVVAMAYEEQNQ
ATLEEAEQKEAEFQQMIEQLKKQQEAAQQAATATASEHSREPSAAGRLSDSSSEASKLSS
KSAKERRNRRKKRKQKEQSGGEEKDEDEFHKSESEDSIRRKGFRFSIEGNRLTYEKRYSS
PHQSLLSIRGSLFSPRRNSRTSLFSFRGRAKDVGSENDFADDEHSTFEDNESRRDSLFVP
RRHGERRNSNLSQTSRSSRMLAVFPANGKMHSTVDCNGVVSLVGGPSVPTSPVGQLLPEG
TTTETEMRKRRSSSFHVSMDFLEDPSQRQRAMSIASILTNTVEELEESRQKCPPCWYKFS
NIFLIWDCSPYWLKVKHVVNLVVMDPFVDLAITICIVLNTLFMAMEHYPMTDHFNNVLTV
GNLVFTGIFTAEMFLKIIAMDPYYYFQEGWNIFDGFIVTLSLVELGLANVEGLSVLRSFR
LLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKSYKDCVCK
IASDCQLPRWHMNDFFHSFLIVFRVLCGEWIETMWDCMEVAGQAMCLTVFMMVMVIGNLV
VLNLFLALLLSSFSADNLAATDDDNEMNNLQIAVDRMHKGVAYVKRKIYEFIQQSFIRKQ
KILDEIKPLDDLNNKKDSCMSNHTTEIGKDLDYLKDVNGTTSGIGTGSSVEKYIIDESDY
MSFINNPSLTVTVPIAVGESDFENLNTEDFSSESDLEESKEKLNESSSSSEGSTVDIGAP
AEEQPVVEPEETLEPEACFTEGCVQRFKCCQINVEEGRGKQWWNLRRTCFRIVEHNWFET
FIVFMILLSSGALAFEDIYIDQRKTIKTMLEYADKVFTYIFILEMLLKWVAYGYQTYFTN
AWCWLDFLIVDVSLVSLTANALGYSELGAIKSLRTLRALRPLRALSRFEGMRVVVNALLG
AIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFYHCINTTTGDRFDIEDVNNHTDCLKLIER
NETARWKNVKVNFDNVGFGYLSLLQVATFKGWMDIMYAAVDSRNVELQPKYEESLYMYLY
FVIFIIFGSFFTLNLFIGVIIDNFNQQKKKFGGQDIFMTEEQKKYYNAMKKLGSKKPQKP
IPRPGNKFQGMVFDFVTRQVFDISIMILICLNMVTMMVETDDQSEYVTTILSRINLVFIV
LFTGECVLKLISLRHYYFTIGWNIFDFVVVILSIVGMFLAELIEKYFVSPTLFRVIRLAR
IGRILRLIKGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYAIFGMSNFAYVKREVGID
DMFNFETFGNSMICLFQITTSAGWDGLLAPILNSKPPDCDPNKVNPGSSVKGDCGNPSVG
IFFFVSYIIISFLVVVNMYIAVILENFSVATEESAEPLSEDDFEMFYEVWEKFDPDATQF
MEFEKLSQFAAALEPPLNLPQPNKLQLIAMDLPMVSGDRIHCLDILFAFTKRVLGESGEM
DALRIQMEERFMASNPSKVSYQPITTTLKRKQEEVSAVIIQRAYRRHLLKRTVKQASFTY
NKNKIKGGANLIKEDMIIDRINENSITEKTDLTMSTAACPPSYDRVTKPIVEKHEQEGKD
EKAKGK
Download sequence
Identical sequences ENSPANP00000018412

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]