SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000018415 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000018415
Domain Number 1 Region: 1116-1313,1341-1366
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 7.85e-26
Family Voltage-gated potassium channels 0.022
Further Details:      
 
Domain Number 2 Region: 801-949,987-1064
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.73e-24
Family Voltage-gated potassium channels 0.026
Further Details:      
 
Domain Number 3 Region: 370-518,552-597
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4e-21
Family Voltage-gated potassium channels 0.02
Further Details:      
 
Domain Number 4 Region: 9-128,198-266
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 7.77e-17
Family Voltage-gated potassium channels 0.025
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000018415
Domain Number - Region: 1371-1416
Classification Level Classification E-value
Superfamily EF-hand 0.00131
Family Polcalcin 0.096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000018415   Gene: ENSPANG00000013338   Transcript: ENSPANT00000007555
Sequence length 1548
Comment pep:known_by_projection chromosome:PapAnu2.0:12:28372857:28445039:-1 gene:ENSPANG00000013338 transcript:ENSPANT00000007555 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLTNLPKWRPVLENTLLGIYTFEILVKLFARGVWAGSFSFLGDPWNWLDFSVTVFEVII
RYSPLNFIPMLQTARTLRILKIIPLNQGLKSLAGVLTHCLKKLIGVIILTLFFLSVFSLI
GMGLFMGNLKHKCFRWPQENENETLHNKTGNPYYIRETENFYYLEGERYALLCGNRTDAG
QCPEGYVCVKAGINPDQGFTNFDSFGWALFALFRLMAQDYPEVLYHQILYASGKVYMIFF
VVVSFWFSFYMASLFLGILAMAYEEEKQRVGQTSKKIEPKFQQTGKELQEGNETDEAKTI
QIEMKKRSPTSTDTSLDVLEDATLRHKEELEKSKKICPLYWYKFATTFLIWNCSPCWSKL
KEFVHRIVMAPFTDLFLIICIILNICFLALERYPMSKSTNNLLNIGNLVFIGIFTAEMIF
KIIAMHPYGYFQVGWNIFDSVIVFHGLTELCLANVEGMALLRLFRMLRIFKLGKYWPTFQ
ILMWSLSNAWVTLRDLVLLLFTFMFFSAAFGMRLFGQNYEEFVCHIDKNCQLPRWHMHDF
FHSYLNVFRILCGEWVETLWDCMEVAGQSWCIPFYLMVILIGNLLVVYLFLALVSSFSSC
KDVTAEENNEAKNLQLAVARIKKGINYVLLKILCKKQNVPKDTMDHVNEVYVKEDISDHT
LSELSNAQDFLKDKEKSSGTEKNTTENEIQSLIPSPSVSETVPIASGESDIENPDNKEIQ
SKSGDGDSKEKIKQSSSSECSTVDIAISEEEEMFYGSERSKHPKNGCGRGSSLGQTSGAS
KKGKIWQNIRKTCCKIVENNWFKCFIGLVTLLSTGTLAFEDIYIDQRKTIKILLEYADMI
FTYIFILEMLLKWMAYGFKAYFSNGWYRLDFVVVIVFCLSLIGKTREELKPLISMKFLRP
LRVLSQFERMKVVVRALIKTTLPTLNVFLVCLMIWLIFSIMGVDLFAGRFYECIDPTNGE
RFPSSEVVNKSQCESLLFNESMPWENAKMNFDNVGNGFLSLLQVATFNGWITIMNSAIDS
VAVNIQPHFEVNIYMYCYFINFIIFGVFLPLSMLISVIIDNFNKHKIKLGGSNIFITVKQ
RKQYGRLKKLMYEDSQRPVPRPRNKLQGFIFDLVTSQVFNVIVMVLICFQAIAMMIDTDG
QSLEMYIALYWINSIFVMLYTMECILKLIALRCFYFTIVWNIFDFMVVIFSITGLCLPMT
VGSYLVSPSFVQLILLSRIIHMLRLGKGPKVFHNLILPLMLSLPALLNIILLIFLVMFIY
AIFGMYNFAYVKKEAGINDVSNFETFGSSMLCLFQVAIFAGWDGMLDAIFNSKWSDCDPD
KINPGTQVRGDCGNPSVGIFYFVSYILISWLIIVNMYIVVVMEFLNIASKKKNKTLSEDD
FRKFFQVWKRFDPDRTQYIDSSKLSDFAAALDPPLFMAKPNKGQLIALDLPMAVGDRIHC
LDILLAFTKRVMGQDVRMEKLLSEIESGFLLANPFKITCEPITTTLKRKQEAVSATIIQR
AYKNYRLRRNDKNTSHIHMIDDDRDVHATKEGAYFDKAKEKSPIQSQI
Download sequence
Identical sequences A0A096NZ94
ENSPANP00000018415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]