SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000018420 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000018420
Domain Number 1 Region: 14-267
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.77e-47
Family FCH domain 0.0033
Further Details:      
 
Domain Number 2 Region: 410-487
Classification Level Classification E-value
Superfamily SH3-domain 7.88e-17
Family SH3-domain 0.0015
Further Details:      
 
Domain Number 3 Region: 302-361
Classification Level Classification E-value
Superfamily HR1 repeat 0.0000549
Family HR1 repeat 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000018420   Gene: ENSPANG00000018065   Transcript: ENSPANT00000014474
Sequence length 510
Comment pep:known_by_projection chromosome:PapAnu2.0:12:30731450:30794727:1 gene:ENSPANG00000018065 transcript:ENSPANT00000014474 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRDPLTDCPYNKVYKNLKEFSQNGENFCKQVTSVLQQRANLEISYAKGLQKLASKLSKAL
QNTRKSCISSAWAWASEGMKSTADLHQKLGKAIELEAIKPTYQALNVQEKKRKSLDNEVE
KTANLVISNWNQQIKAKKKLMVSTKKHEALFQLVESSKQSTTEKERRKLLNKLTKSTEKL
EKEDENYYQKNMVGYSTRLKWENTLENCYQSILELEKERIQLLCNNLNQYSQHISLFGQT
LTTCHTQIHCAISKIDIEKDIQAVMEETAILSTENKSEFLLTDYFEEDPNSAMDKERRKS
LIKPKLLRLQRDIEKASKDKEGLERMLKTYSSNSSFSDAKGQKDTAALMDENNLKLDLLE
ANSYKLSSVLAELEQRPQPSHPCSNSIFRWREKEHTHSYVKISRPFLMKRLESIVSKASS
GGQSNPSSSTPVPGAAQLSSRLCKALYSFQARQDDELNLEKGDIVIIHEKKEEGWWFGSL
NGKKAIFLPLMWRSYLQMLATQLQRHKTRL
Download sequence
Identical sequences ENSPANP00000018420

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]