SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000018429 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000018429
Domain Number 1 Region: 560-639,667-698,863-932
Classification Level Classification E-value
Superfamily TPR-like 0.000000000157
Family Tetratricopeptide repeat (TPR) 0.019
Further Details:      
 
Domain Number 2 Region: 284-361
Classification Level Classification E-value
Superfamily SH3-domain 0.000000018
Family SH3-domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000018429   Gene: ENSPANG00000007834   Transcript: ENSPANT00000024638
Sequence length 984
Comment pep:novel chromosome:PapAnu2.0:5:557149:592474:-1 gene:ENSPANG00000007834 transcript:ENSPANT00000024638 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MENLPAVITEEPTPMGRGPVGPSGGGSSRDHVWTMTTRPSVSWEKAGPEEAKAPGRGDEA
SPTRVAGPAAGTPPWQMGAYPTDLTLQLLAVRRKSGLQDPGLQQTLRGQLRLLENDSREM
ARVLGELSARLLSIHSDQDRIVVTFKTFEEIWKFSTYHALGFTHHCLANLLMDQAFWLLS
PSEEEETAIQVHVDENALRLTHESLLVQEGPFFVLCPDHHVRVMTGPRDAGNGPQALRQA
SGAPQGEAAPEADSSPPSPSVSSEEVAVAAAPEPLIPFHQWALRVPQDPIDDAMGGPVTP
DNPLMAVGLAWALADFQGSGPEEMTFQGGDLIEILGAQVPGLPWCVGRHAASGQVGFVRS
DLISMQGLVSELESAIFLNEEEKSFFSEGRFSEEDARQLLRRMSGTDVCSVYSLDSVEEA
ETEQPQEREIPPPCLGPEPQETLQKVKNVLEQCKTCPGCPQEPVSWGLCAASSNVSLQDP
EEPSFCLEAEDDWEDPEALSSLLLFLNAPGYKASFRGLYDVALPWLSSVFCSFSDEEELT
GRLAQARGAAKNAGLVMALARLCFLLGRLCSRRLKLSQARVYFEEALGALEGSFGDLFLV
VAVYANLASIYRKQKNREKCTQVVPKAMALLLGTPGHICSTEAEGELLQLALRWAVGGQS
LQAEARACFLLARHHVHLKQPEEALPFLERLLLLHRDSGAPEAAWLSDCSLLLADIYSHK
CLPHLVLSCVKVASLRTQDSLAGSLRSVNLVLQNALQPHGLPTQTSHYLRRALASLTPGA
GQALRGLLHASLAQLYSHHGYHGPAITFMTQAVEASAVAGVRAIVDRLLALAWLHVLHGQ
SPVALDILQSVQDAVVASEDQEGVIANMVAVALKRTGRTRQAAEGYYRALRVARDLGQQR
NQAVVLANFGALCLHAGASRLAQHYLLEAVRLFSRLPCRECGRDFTHVLLQLGHLCTRQG
PAQGKGYYEWALLVAMEMGHVESE
Download sequence
Identical sequences ENSPANP00000018429

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]