SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000018439 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000018439
Domain Number 1 Region: 3198-3462
Classification Level Classification E-value
Superfamily YWTD domain 6.41e-52
Family YWTD domain 0.00000286
Further Details:      
 
Domain Number 2 Region: 396-657
Classification Level Classification E-value
Superfamily YWTD domain 6.41e-44
Family YWTD domain 0.00000934
Further Details:      
 
Domain Number 3 Region: 1437-1698
Classification Level Classification E-value
Superfamily YWTD domain 6.54e-44
Family YWTD domain 0.00000955
Further Details:      
 
Domain Number 4 Region: 2388-2631
Classification Level Classification E-value
Superfamily YWTD domain 3.27e-37
Family YWTD domain 0.0000192
Further Details:      
 
Domain Number 5 Region: 1745-2012
Classification Level Classification E-value
Superfamily YWTD domain 1.44e-36
Family YWTD domain 0.0000889
Further Details:      
 
Domain Number 6 Region: 4042-4313
Classification Level Classification E-value
Superfamily YWTD domain 3.79e-36
Family YWTD domain 0.0000288
Further Details:      
 
Domain Number 7 Region: 2064-2334
Classification Level Classification E-value
Superfamily YWTD domain 7.72e-36
Family YWTD domain 0.0000316
Further Details:      
 
Domain Number 8 Region: 711-962
Classification Level Classification E-value
Superfamily YWTD domain 7.85e-36
Family YWTD domain 0.0000548
Further Details:      
 
Domain Number 9 Region: 305-385,650-706
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000126
Family Growth factor receptor domain 0.022
Further Details:      
 
Domain Number 10 Region: 1352-1429,1690-1736
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000129
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 11 Region: 1064-1102
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000106
Family LDL receptor-like module 0.00095
Further Details:      
 
Domain Number 12 Region: 2734-2775
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000131
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 13 Region: 3143-3191
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000363
Family EGF-type module 0.0078
Further Details:      
 
Domain Number 14 Region: 3614-3653
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000537
Family LDL receptor-like module 0.00066
Further Details:      
 
Domain Number 15 Region: 2856-2895
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000903
Family LDL receptor-like module 0.00059
Further Details:      
 
Domain Number 16 Region: 2986-3027
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000114
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 17 Region: 1264-1305
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000144
Family LDL receptor-like module 0.0009
Further Details:      
 
Domain Number 18 Region: 1146-1183
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000017
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 19 Region: 3025-3065
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000196
Family LDL receptor-like module 0.00076
Further Details:      
 
Domain Number 20 Region: 26-63
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000419
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 21 Region: 3705-3742
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000419
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 22 Region: 3068-3108
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000484
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 23 Region: 3784-3821
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000055
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 24 Region: 2698-2741
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000641
Family LDL receptor-like module 0.00076
Further Details:      
 
Domain Number 25 Region: 3740-3780
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000707
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 26 Region: 1022-1059
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000929
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 27 Region: 102-143
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000995
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 28 Region: 2902-2938
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000123
Family LDL receptor-like module 0.00059
Further Details:      
 
Domain Number 29 Region: 3828-3865
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000017
Family LDL receptor-like module 0.00093
Further Details:      
 
Domain Number 30 Region: 1105-1142
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000183
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 31 Region: 216-256
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000236
Family LDL receptor-like module 0.00092
Further Details:      
 
Domain Number 32 Region: 3572-3616
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000327
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 33 Region: 182-217
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000353
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 34 Region: 1185-1223
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000589
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 35 Region: 1228-1264
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000864
Family LDL receptor-like module 0.00075
Further Details:      
 
Domain Number 36 Region: 65-101
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000995
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 37 Region: 3110-3157
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000122
Family EGF-type module 0.008
Further Details:      
 
Domain Number 38 Region: 3533-3575
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000144
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 39 Region: 3913-3949
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000017
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 40 Region: 2812-2858
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000209
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 41 Region: 264-300
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000262
Family LDL receptor-like module 0.0024
Further Details:      
 
Domain Number 42 Region: 3869-3907
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000707
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 43 Region: 2017-2066
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000977
Family EGF-type module 0.023
Further Details:      
 
Domain Number 44 Region: 1309-1345
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000011
Family LDL receptor-like module 0.0031
Further Details:      
 
Domain Number 45 Region: 2942-2985
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000288
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 46 Region: 3994-4028
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000466
Family EGF-type module 0.0086
Further Details:      
 
Domain Number 47 Region: 3668-3701
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000825
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 48 Region: 146-180
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000236
Family LDL receptor-like module 0.0021
Further Details:      
 
Domain Number 49 Region: 2782-2816
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000038
Family LDL receptor-like module 0.0022
Further Details:      
 
Domain Number 50 Region: 4368-4401
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000544
Family EGF-type module 0.02
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000018439
Domain Number - Region: 2340-2384
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000387
Family EGF-type module 0.019
Further Details:      
 
Domain Number - Region: 3956-3995
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00335
Family EGF-type module 0.024
Further Details:      
 
Domain Number - Region: 2653-2713
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00762
Family EGF-type module 0.023
Further Details:      
 
Domain Number - Region: 979-1014
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0137
Family EGF-type module 0.013
Further Details:      
 
Domain Number - Region: 4322-4347
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0146
Family EGF-type module 0.024
Further Details:      
 
Domain Number - Region: 3467-3528
Classification Level Classification E-value
Superfamily EGF/Laminin 0.019
Family EGF-type module 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000018439   Gene: ENSPANG00000007656   Transcript: ENSPANT00000013114
Sequence length 4642
Comment pep:known_by_projection chromosome:PapAnu2.0:12:31066002:31284284:-1 gene:ENSPANG00000007656 transcript:ENSPANT00000013114 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDRGPAAVACTLLLALVACLAPASGQECDSEHFRCGNGHCIPADWRCDGTKDCSDDTDEI
GCAVVTCQQGYFKCQSEGQCIPNSWVCDQDQDCDDGSDEHQGCSQSTCSSHQITCSNGQC
IPGEYRCDHVRDCPDGADENDCQYPTCEQLTCDNGACYNTSQKCDWKVDCRDSSDEINCT
EICLHNEFSCGSGECIPHAYVCDHDSDCQDGSDEHACNYPTCGGYQFTCPSGRCIYQNWV
CDGEDDCKDNGDEDGCESSSHGVHKCSPREWSCPESGRCISIYKVCDGILDCPGREDENS
TTTGKYCSTTLCSALNCQYQCHETPYGGACFCPPGYTINHNDSRTCVEFDDCQIWGICDQ
KCESRPGHHLCHCEEGYILERGQHCKANDSFGEASIIFSNGRDLLIGDIHGRSFRILVES
QNRGVAVGVAFHYHLQRVFWTDTVQNKVFSVDIHGLNIQEVLNVSVETPENLAVDWVNNK
IYLVETKVNRIDMVNLDGSYRVTLITENLGHPRGIAVDPTVGYLFFSDWESLSGEPKLER
AFMDGSNRKDLVKTKLGWPAGVTLDMISKRVYWVDSRFDYIETVTYDGIQRKTVVHGGSL
IPHPFGISLFEGQVFFTDWTKMAVLKANKFAETNPQVYYQASLRPYGVTVYHSLRQPYAT
NPCKDNNGGCEQVCVLSHRTDNDGLGFRCKCTFGFQLGTDERHCIAVQNFLIFSSQVAIR
GIPFTLSTQEDVMVPVSGNPSFFVGIDFDAQDSTIFFSDMSKHMIFKQKIDGTGREILAA
NRVENVESLAFDWISKNLYWTDSHYKSISVMRLADKMRRTVVQYLNNPRSVVVHPFAGYL
FFTDWFRPAKIMRAWSDGSHLLPIVNTTLGWPNGLAIDWAKSLESINQQMHICLHALWEN
FEXRRLGHIEQMTHPFGLAIFGEHLFFTDWRLGAVIRVRKADGGEMTVIRSGIAYILHLK
SYDVNIQTGSNACNQPTHPNGDCSHFCFPVPNFQRVCGCPYGMRLASNHLTCEGDPTNEP
PTEQCGVFSFPCKNGRCVPSYYRCDGVNDCHDNSDEQLCGTLNNTCSSSAFTCGNGECIP
AHWRCDKRNDCVDGSDEHNCPTHAPASCLDTQYTCDNHQCISKNWVCDTDNDCGDGSDEK
NCNSTEICQPSQFNCPNHRCIDLSFVCDGDKDCVDGSDEVGCVLNCTASQFKCASGDKCI
SVTNRCDGVFDCSDNSDEAGCPTRPPGMCHSDEFQCQEDGICIPNFWECDGHPDCLYGSD
EHNACVPKTCPSSYFHCDNGNCIHRAWLCDRDNDCGDMSDEKDCPTQPFRCPSWQWQCLG
YNICVNMSVVCDGIFDCPNGTDESPLCNGNSCSDFNGGCTHECVQEPFGAKCLCPLGFLL
ANDSKTCEDVDECDIPGSCSQHCYNMRGSFRCSCDTGYMLESDGRTCKVTASENLLLLVA
SQNKIIADSVTSQVHNIYSLVENGSYIVAVDFDSISGRIFWSDATQGKTWSAFQNGTDRR
VVFDSSIILTETIAIDWVGRNLYWTDYALETIEVSKIDGSHRTVLISKNLTNPRGLALDP
RMNEHLLFWSDWGHHPRIERASMDGSMRTVIVQDKIFWPCGLTIDYPNRLLYFMDSYLDY
IDFCDYNGHHRRQVIASDLIIRHPYALTLFEDSVYWTDRATRRVMRANKWHGGNQSVVMY
NIQWPLGIVAVHPSKQPNSVNPCAFSRCSHLCLLSSQGPHFYSCVCPSGWSLSPDLLNCL
RDDQPFLITVRQHIIFGISLNPDVKSNDAMVPIAGIQNGLDVEFDDAEQYIYWVENPGEI
HRVKTDGTNRTVFASVSMVGPSMNLALDWVSRNLYSTNPRTQSIEVLTLHGDIRYRKTLI
ANDGTALGVGFPIGITVDPTRGKLYWSDQGTDSGVPAKIASANMDGTSVKTLFTGNLEHL
ECVTLDIEEQKLYWAVTGRGVIERGNVDGTDRMILVHQLSHPWGIAVYDSFLYYTDEQYE
VIERVDKATGANKIVLRDNVPNLRGLRVYHRRNTVESSNGCSNNMNACQQICLPVPGGLF
SCACATGFKLNPDNRSCSPYNSFIVVSMLSAIRGFSLELSDHSETMVPVAGQGRNALHVD
VDVSSGFVYWCDFSSSVASDNAIRRIKPDGSSLMNIVTHGIGENGVRGIAVDWVAGNLYF
TNAFVSETLIEVLRINTTYRRVLLKVTVDMPRHIVVDPKNRYLFWADYGQRPKIERSFLD
CTNRTVLVSEGIVTPRGLAVDRSDGYVYWVDDSLDIIARIHINGENSEVIRYGSRYPTPY
GITVFGNSIIWVDRNLKKIFQASKEPENTDPPTVIRDNINWLRDVTIFDKQVQPQSPAEV
NNNPCLENNGGCSHLCFALPGLYTPKCDCAFGTLESDGKNCAISTENFLIFALSNSLRSL
HLDPENHSPPFQTINVERTVMSLDYDSVSDRIYFTQNLASGVGQISYVSLSSGIHTPTVI
ASGIGTADGIAFDWITRRIYYSDYLNQTINSMAEDGSNRTVIARVPKPRAIVLDPCQGYL
YWADWDMHAKIERATLGGNFRVPIVNSSLVMPSGLTLDYEEDLLYWVDASLQKIERSTLT
GMDREVIVNAAVHAFGLTLYGQYIYWTDLYTQRIYRANKYDGSGQIAMTTNLLSQPRGIN
TVVKNQKEQCNNPCEQFNGGCSHICAPGPNGAECQCPHEGNWYLANNRKHCIVDNGERCA
ASSFTCSNGRCISKEWKCDNDNDCGDGSDEMESVCALHTCSPTAFTCANGRCVQYSYRCD
YYNDCGDGSDEAGCLFRDCNATTEFMCNNRRCIPREFVCNGVDNCHDNNTSDEKNCPDRT
CQSGYTKCQNSNICIPRIYLCDGDNDCGDNSDENPTYCTTHTCSSSEFQCTSGRCIPQHW
YCDQEIDCSDASDEPASCGHPERTCLADEFKCDRGRCIPSEWICDGDNDCGDMSDEDERH
QCQNQNCSDSEFLCVNDRPPDRRCIPQSWVCDGDVDCTDGYDENQNCTRRTCSENEFTCG
YGLCIPEIFRCDRHNDCGDYSDERGCLYQTCQQNQFTCQNGRCISKTFVCDEDNDCGDGS
DELMHLCHTPEPTCPPHEFKCDNGRCIEMMKLCNHLDDCLDNSDEKGCGVNECHDPSISG
CDHNCTDTLTSFYCSCRPGYKLMSDKRTCVDIDECTETPFVCSQKCENVIGSYICKCAPG
YLREPDGKTCRQNSNIEPYLIFSNRYYLRNLTIDGYFYSLILEGLGNVVALDFDRVEKRL
YWIDTQRQVIERMFLNKTNKETIINHRLPAAESLAVEWVSRKLYWLDARLDGLFVSDLNG
GHRRMLAQHCVDANNTFCFDNPRGLALHPQYGYIYWADWGHRAYIGRVGMDGTNKSVIIS
TKLEWPNGITIDYTNDLLYWADAHLGYIEYSDLEGHRRHTVYDGTLPHPFAITIFEDTIY
WTDWNTRTVEKGNKYDGSNRQTLVNTTHRPFDIHVYHPYRQPIVSNPCGTNNGGCSHLCL
IKPGGKGFTCECPDDFRTLQLSGSTYCMPMCSSTQFLCANNEKCIPIWWXELALCPQRFC
RLGQFQCNDGNCTSPQTLCNAHQNCPDGSDEDRLLCENHHCDSNEWQCANKRCIPESWQC
DTFNDCEDNSDEDSSHCASRTCRPGQFRCANGRCIPQAWKCDVDNDCGDHSDEPIEECMS
SAHLCDNFTEFSCKTNYRCIPKWAACNGVDDCRDNSDEQGCEERTCHPVGDFRCKNHHCI
PLRWQCDGQNDCGDNSDEENCAPRECTESEFRCVNQQCIPSRWICDHYNDCGDNSDERDC
EMRTCHPEYFQCTSGHCVPSELKCDGTADCLDASDEADCPTRFPDGAYCQATMFECKNHV
CIPPYWKCDGDDDCGDGSDEELHLCLNVPCNSPNRFRCDNNRCIYGHEVCNGVDDCGDGT
DETEEHCRKPTPKPCTEYEYKCGNGHCIPNDNVCDDADDCGDWSDELGCNKGKERTCAEN
ICEQNCTQLNEGGFICSCTAGFETNVFDRTSCLDINECEQFGTCPQHCRNTKGSYECVCA
DGFTSMSDHPGKRCAAEGSSPLLLLPDNVRIRKYNLSSERFSEYLQDEEYIQAVDYDWDP
EDIGLSVVYYTVRGEGSRFGAIKRAYIPNFESGHNNLVQEVDLKLKYVMQPDGIAVDWVG
RHIYWSDVKNKRIEVAKLDGRYRKWLISTDLDQPAAIAVNPKLGLMFWTDWGKEPKIESA
WMNGEDRNILVFKDLGWPTGLSIDYLNNDRIYWSDFKEDVIETIKYDGTDRRVIAKEAMN
PYSLDIFEDQLYWISKEKGEVWKQNKFGQGKKEKTLVVNPWLTQVRIFHQLRYNKSVPNL
CKQICSHLCLLRPGGYSCACPQGSSFIEGSTTECDAAIELPINLPPPCRCMHGGNCYFDE
TDLPKCKCPSGYTGKYCEMAFSKGISPGTTAVAVLLTILLIVIIGALAIAGFFHYRRTGS
LLPALPKLPSLSSLVKPSENGNGVTFRSGADLNMDIGVSGFGPETAIDRSMAMSEDFVME
MGKQPIIFENPMYSVRDSAVKVVQPTQVTVSGNVDNKNYGSPINPSEIVPETSPTSPAAD
GTQVTKWNLFKRKTKQTTNFENPIYAQMENKQKETVAATPPPSPSLPAKPKPPSRRDPTP
TYSATEDTFKDTAHLVKEDSEV
Download sequence
Identical sequences ENSPANP00000018439

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]