SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000018440 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPANP00000018440
Domain Number - Region: 148-220
Classification Level Classification E-value
Superfamily PH domain-like 0.00101
Family TFIIH domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000018440   Gene: ENSPANG00000010872   Transcript: ENSPANT00000010234
Sequence length 341
Comment pep:known_by_projection chromosome:PapAnu2.0:12:31384345:31415245:1 gene:ENSPANG00000010872 transcript:ENSPANT00000010234 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVLDALWEDRDVRFDLSSQQMKTRPGEVLIDCLDSIEDTKGNNGDRGRLLVTNLRILWH
SLALSRVNVSVGYNCILNITTRTANSKLRGQTEALYILTKCNSTRFEFIFTNLVPGSPRL
FTSVMAVHRAYETSKMYRDFKLRSALIQNKQLRLLPQEHVYDKINGVWNLSSDQGNLGTF
FITNVRIVWHANMNDSFNVSIPYLQIRSIKIRDSKFGLALVIESSQQSGGYVLGFKIDPV
EKLQESVKEINSLHKVYSASPIFGVDYEMEEKPQPLEALTVEQIQDDVEIDSDDHTDAFV
AYFADGNKQQDREPVFSEELGLAIEKLKDGFTLQGLWEVMS
Download sequence
Identical sequences A0A096NZB9 A0A0D9RRT6 A0A2K5LNC6 A0A2K5Z6D8 A0A2K6CE66 A0A2K6KG14 A0A2K6NDM7 G7PKR7 H9Z224 Q4R649
9544.ENSMMUP00000027008 XP_001098260.1.72884 XP_007963468.1.81039 XP_010352722.1.97406 XP_011742368.1.29376 XP_011843540.1.47321 XP_011902309.1.92194 XP_015287559.1.63531 XP_017709978.1.44346 ENSMMUP00000027008 ENSMMUP00000027008 ENSPANP00000018440

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]