SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000018467 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000018467
Domain Number 1 Region: 12-162
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 3.32e-30
Family Ta1320-like 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000018467   Gene: ENSPANG00000005422   Transcript: ENSPANT00000022996
Sequence length 210
Comment pep:known_by_projection chromosome:PapAnu2.0:12:31741060:31758974:-1 gene:ENSPANG00000005422 transcript:ENSPANT00000022996 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKKLRLKELESRLQQVDGFEKPKLLLEQYPTRPHIAVACMLYTIHNTYDDIENKVVADLG
CGCGVLSIGTAMLGAGLCVGFDIDEDALEIFNRNVEEFELTNIDMVQCDVCLLSNRMSKS
FDTVIMNPPFGTKNNKGTDMAFLKTALEMARTAVYSLHKSSTREHVQKKAAEWKIKIDVI
AELRYDLPASYKFHKKKSVDIEVDLIRFSF
Download sequence
Identical sequences ENSPANP00000018467

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]