SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000018484 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPANP00000018484
Domain Number - Region: 120-158
Classification Level Classification E-value
Superfamily TPR-like 0.00125
Family Tetratricopeptide repeat (TPR) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000018484   Gene: ENSPANG00000007511   Transcript: ENSPANT00000029035
Sequence length 198
Comment pep:known_by_projection chromosome:PapAnu2.0:12:32739844:32758598:1 gene:ENSPANG00000007511 transcript:ENSPANT00000029035 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HRKEVPSKNIENKVSLKNIENRVSSRSIESKDILTNLQSDLLSSSCLKESTGEVSKDAVT
VKQEKNNDYCLQDIDDKLSESAEDDDEDDTNDEDNDEDSNPKKNTQAPLELMAEFLRAEM
AQEYQLAKKLCQMILIYEPENPEAKEFFTLIEEMLLMEKTQNREQDGEDSDEDSSGESKG
ESDEELSDESSDEGEDGS
Download sequence
Identical sequences ENSPANP00000018484

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]