SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000018511 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000018511
Domain Number 1 Region: 52-229
Classification Level Classification E-value
Superfamily EF-hand 1.46e-48
Family Calmodulin-like 0.000000163
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000018511   Gene: ENSPANG00000001124   Transcript: ENSPANT00000015089
Sequence length 233
Comment pep:known_by_projection chromosome:PapAnu2.0:5:15505766:15759232:-1 gene:ENSPANG00000001124 transcript:ENSPANT00000015089 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLTLEWESEGLQTVGIVVIICASLKLLHLLGLIDFSEDSVEDELEMATVRHRPEALELLE
AQSKFTKKELQILYRGFKNECPSGVVNEETFKEIYSQFFPQGDSTTYAHFLFNAFDTDHN
GAVSFEDFIKGLSILLRGTVQEKLNWAFNLYDINKDGYITKEEMLDIMKAIYDMMGKCTY
PVLKEDAPRQHVETFFQKMDKNKDGVVTIDEFIESCQKDENIMRSMQLFENVI
Download sequence
Identical sequences A0A096NZJ0 A0A1S2ZYC1 A0A1S3EL12 A0A1U7QJD7 A0A287CX19 A0A2K5CAC6 A0A2K5LSE1 A0A2K5W320 A0A2K6KAK2 F7EUP3 M3WLK0 Q3YAA5 Q3YAB7
ENSDNOP00000019671 ENSNLEP00000020307 ENSNLEP00000020307 ENSCJAP00000023749 NP_001186174.1.92730 XP_003258569.1.23891 XP_003310306.1.37143 XP_003732570.1.60252 XP_004415220.1.74151 XP_004482528.1.11602 XP_004579235.1.84141 XP_004616600.1.94378 XP_004624594.1.9945 XP_004656144.1.11716 XP_004762749.1.14098 XP_004847274.1.39548 XP_005068841.1.91757 XP_005248247.1.92137 XP_005318982.1.77405 XP_005366070.1.66349 XP_005402526.1.28644 XP_006884569.1.29581 XP_006919025.1.64745 XP_006976160.1.50099 XP_007526511.1.11023 XP_007609007.1.28591 XP_007951954.1.48129 XP_008015965.1.81039 XP_010375511.1.97406 XP_010589690.1.64505 XP_011280276.2.62641 XP_011363448.1.92234 XP_011749796.1.29376 XP_011791063.1.43180 XP_011849653.1.47321 XP_011900731.1.92194 XP_012327766.1.9421 XP_012516212.1.63892 XP_012593134.1.48125 XP_012864639.1.60039 XP_013834009.1.46622 XP_014993544.1.72884 XP_015337479.1.40921 XP_015976762.1.101085 XP_016073731.1.3490 XP_017396100.1.71028 XP_017454575.1.100692 XP_017536455.1.32401 XP_017722295.1.44346 XP_019309451.1.44245 XP_019652095.1.58354 XP_020008412.1.5219 XP_021066788.1.100879 ENSPANP00000018511 ENSMUSP00000131276 ENSCJAP00000023787

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]