SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000018544 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000018544
Domain Number 1 Region: 604-780
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.92e-41
Family BCR-homology GTPase activation domain (BH-domain) 0.00059
Further Details:      
 
Domain Number 2 Region: 166-281
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 6.28e-36
Family Pyk2-associated protein beta ARF-GAP domain 0.0015
Further Details:      
 
Domain Number 3 Region: 358-519
Classification Level Classification E-value
Superfamily PH domain-like 2.89e-24
Family Pleckstrin-homology domain (PH domain) 0.016
Further Details:      
 
Domain Number 4 Region: 914-1051
Classification Level Classification E-value
Superfamily PH domain-like 1.13e-19
Family Pleckstrin-homology domain (PH domain) 0.019
Further Details:      
 
Domain Number 5 Region: 67-165
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000193
Family Pleckstrin-homology domain (PH domain) 0.016
Further Details:      
 
Domain Number 6 Region: 2-55
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000036
Family Pleckstrin-homology domain (PH domain) 0.00021
Further Details:      
 
Domain Number 7 Region: 496-590
Classification Level Classification E-value
Superfamily PH domain-like 0.000000142
Family Pleckstrin-homology domain (PH domain) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000018544   Gene: ENSPANG00000021175   Transcript: ENSPANT00000008590
Sequence length 1184
Comment pep:known_by_projection chromosome:PapAnu2.0:5:30890539:31008616:-1 gene:ENSPANG00000021175 transcript:ENSPANT00000008590 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYSKGIIPLSAISTVRVQGDNKFEVVTTQRTFVFRVEKEEERNDWISILLNALKSQSLTS
QSQGVVTPEKCGYLELRGYKAKIFTVLSGNSVWLCKNEQDFKSGLGITIIPMNVANVKQV
DRTVKQSFEIITPYRSFSFTAETEKEKQDWIEAVQQSIAETLSDYEVAEKIWFNESNRSC
ADCKAPDPDWASINLCVVICKKCAGQHRSLGPKDSKVRSLKMDASIWSNELIELFIVIGN
KRANDFWAGNLQKDEELHMDSPVEKRKNFITQKYKEGKFRKTLLASLTKEELNKALCAAV
VKPDVLETMALLFSGADVMCATGDPVHSTPYLLAKKAGQSLQMEFLYHNKFSDFPQHDIH
SEGVLSQESSQSTFLCDFLYQAPSAASKLSSEKKLLEETNKKWCVLEGGFLSYYESDKST
TPNGTININEVICLAIHKEDFYLNTGPIFIFEIYLPSERVFLFGAETSQTQRKWTEAIAK
HFVPLFAENLTEADYDLIGQLFYKDCHALDQWRKGWFAMDKSSLHFCLQMQEVQGDRMHL
RRLQELTISTMVQNGEKLDVLLLVEKGRTLYIHGHTKLDFTVWHTAIEKAAGTDGNALQD
QQLSKNDVPIIVNSCIAFVTQYGLGCKYIYQKNGDPLHISELLESFKKDARSFKLRAGKH
QLEDVTGVLKSFLSDIDDALLTKELYPYWISALDAQDDKERIKKYGAFIRSLPGVNRATL
AAIIEHLYRVQKCSEINHMNAHNLALVFSSCLFQTKGQTSEEVNVIEDLINNYVEIFEVK
EDQVKQMDIENSFITKWKDTQVSQAGDLLIEVYVERKEPDCSIIIRISPVMEAEELTNDI
LAIKNIIPTKGDIWATFEVIENEELERPLHYKENVLEQVLRWSSLAEPGSAYLVVKKFLT
ADTIKHCSDRSTLGSIKEGILKIKEEPSKILSGNKFQDRYFVLRDGFLFLYKDVKSSKHD
KMFSLSSVKFYRGVKKKMKPPTSWGLTAYSEKHHWHLCCDSSRTQTEWMTSIFIAQHEND
IWPPAGKERKRSITKNPKIGGLPLIPIQHEGNATLARKNIESARAELERLRLIEKCDKES
VDSSLKERASMVAHCLEHKDDKLRNRTRKHRSFNCLEDTEPEAPLGQPKGHKGLKTLRKT
EDRNSKATLDSDHKLPSRVIEELNVVLQRSRTLPRELQDEQILK
Download sequence
Identical sequences ENSPANP00000018544

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]