SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000018553 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000018553
Domain Number 1 Region: 659-770
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 7.06e-40
Family Pyk2-associated protein beta ARF-GAP domain 0.00046
Further Details:      
 
Domain Number 2 Region: 117-286
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.46e-33
Family G proteins 0.00000192
Further Details:      
 
Domain Number 3 Region: 385-459,598-643
Classification Level Classification E-value
Superfamily PH domain-like 1.51e-16
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 
Domain Number 4 Region: 782-872
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000000000622
Family Ankyrin repeat 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000018553   Gene: ENSPANG00000015086   Transcript: ENSPANT00000021665
Sequence length 904
Comment pep:known_by_projection chromosome:PapAnu2.0:3:172381103:172438846:1 gene:ENSPANG00000015086 transcript:ENSPANT00000021665 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ARGSGVEAEESASLRVPEPAGAAVRAHDAGGGPGPRAPGPVPSQQLAGGPPQQFALSNSA
AIRAEIQRFESVHPNIYAIYDLIERIEDLALQNQIREHVISIEDSFVNSQEWTLSRSVPE
LKVGIVGNLSSGKSALVHRYLTGTYVQEESPEGGRFKKEIVVDGQSYLLLIRDEGGPPEL
QFAAWVDAVVFVFSLEDEISFQTVYNYFLRLCSFRNASEVPMVLVGTQDAISAANPRVID
DSRARKLSTDLKRCTYYETCATYGLNVERVFQDVAQKVVALRKKQQLAIGPCKSLPNSPS
HSAVSAASIPAVHINQATNGGGSAFSDYSSSVPSTPSISQRELRIETIAASSTPTPIRKQ
SKRRSNIFTSRKGADLDREKKAAECKVDSIGSGRAIPIKQGILLKRSGKSLNKEWKKKYV
TLCDNGLLTYHPSLHDYMQNIHGKEIDLLRTTVKVPGKRLPRATPATAPGTSPRANGLSV
ERSNTQLGGGTGAPHSASSASLHSERPLSSSAWAGPRPEGLHQRSCSVSSADQWSEATTS
LPPGMQHPASGPAEVLSSSPKLDPPPSPHSNRKKHRRKKSTGTPRPDGPSSAAEEAEESF
EFVVVSLTGQTWHFEASTAEERELWVQSVQAQILASLQGCRSAKDKTRLGNQNTALAVQA
VRTVRGNSFCIDCDAPNPDWASLNLGALMCIECSGIHRHLGAHLSRVRSLDLDDWPPELL
AVMTAMGNALANSVWEGALGGYSTPGPDACREEKERWIRAKYEQKLFLAPLPSSDVPLGQ
QLLRAVVEDDLRLLVMLLAHGSKEEVNETYGDGDGRTALHLSSAMANVVFTQLLIWYGVD
VRSRDARGLTPLAYARRAGSQECADILIQHGCPGEGCGLVPTPNREPANGTNPSAELHRS
PSLL
Download sequence
Identical sequences ENSPANP00000018553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]