SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000018555 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000018555
Domain Number 1 Region: 391-694
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 2.4e-102
Family PDEase 0.000000665
Further Details:      
 
Domain Number 2 Region: 177-368
Classification Level Classification E-value
Superfamily GAF domain-like 5.45e-48
Family GAF domain 0.000029
Further Details:      
 
Domain Number 3 Region: 20-169
Classification Level Classification E-value
Superfamily GAF domain-like 5.45e-20
Family GAF domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000018555   Gene: ENSPANG00000019045   Transcript: ENSPANT00000001597
Sequence length 709
Comment pep:known_by_projection chromosome:PapAnu2.0:4:160462433:160663952:-1 gene:ENSPANG00000019045 transcript:ENSPANT00000001597 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQGVVYELNSYIEQRLDTGGDNQLLLYELSSIIKIATKADGFALYFLGECNNSLCIFTPP
GIKEGKPRLIPAGPITQGTTISAYVAKSRKTLLVEDILGDERFPRGTGLESGTRIQSVLC
LPIVTAIGDLIGILELYRHWGKEAFCLSHQEVATANLAWASVAIHQVQVCRGLAKQTELN
DFLLDVSKTYFDNIVAIDSLLEHIMIYAKNLVNADRCALFQVDHKNKELYSDLFDIGEEK
EGKPVFKKTKEIRFSIEKGIAGQVARTGEVLNIPDAYADPRFNREVDLYTGYTTRNILCM
PIVSRGSVIGVVQMVNKISGSAFSKTDENNFKMFAVFCALALHCANMYHRIRHSECIYRV
TMEKLSYHSICTAEEWQGLMRFTLPVRLCKEIELFHFDIGPFENMWPGIFVYMVHRSCGT
SCFELEKLCRFIMSVKKNYRRVPYHNWKHAVTVAHCMYAILQNNHALFTDLERKGLLIAC
LCHDLDHRGFSNTYLQKFDHPLAALYSTSTMEQHHFSQTVSILQLEGHNIFSTLSSSEYE
QVLEIIRKAIIATDLALYFGNRKQLEEMYQTGSLNLNNQSHRDRVIGLMMTACDLCSVTK
LWPVTKLTANDIYAEFWAEGDEMKKLGIQPIPMMDRDKKDEVPQGQLGFYNAVAIPCYTT
LTQILPPTEPLLKACRDNLNQWEKVIRGEETATWISSPSVAQKAAASED
Download sequence
Identical sequences A0A2K5WSG6 A0A2K6B765
ENSPANP00000018555 XP_005551533.1.63531 XP_011749312.1.29376 XP_011749313.1.29376 XP_011749314.1.29376 XP_011749315.1.29376 XP_015303990.1.63531 XP_015303991.1.63531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]