SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000018611 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000018611
Domain Number 1 Region: 61-172
Classification Level Classification E-value
Superfamily SH2 domain 3.37e-20
Family SH2 domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000018611   Gene: ENSPANG00000004074   Transcript: ENSPANT00000005642
Sequence length 190
Comment pep:known_by_projection chromosome:PapAnu2.0:13:84177271:84181937:1 gene:ENSPANG00000004074 transcript:ENSPANT00000005642 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCPQLTGAVSLLVARKQRPVFGRREQGASSRVVLGPPKKPDEDLYLECEPDAGRKSSFPS
VAPVGSASTAEDSDLLAQPWYSGNCDRHAVESALLRLQKDGAYTVRPSSGPHGSQPFTLA
VLLRGRVFNIPIRRLDGGRHYALGREGRNHEELFSSVATMVQHFMRHPLPLVDRHSGSRE
LTCLLFPTKP
Download sequence
Identical sequences ENSPANP00000018611

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]