SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000018642 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000018642
Domain Number 1 Region: 109-309
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 6.11e-46
Family Reprolysin-like 0.00025
Further Details:      
 
Domain Number 2 Region: 358-404
Classification Level Classification E-value
Superfamily Blood coagulation inhibitor (disintegrin) 0.0000000209
Family Blood coagulation inhibitor (disintegrin) 0.0044
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000018642
Domain Number - Region: 548-587
Classification Level Classification E-value
Superfamily EGF/Laminin 0.046
Family Integrin beta EGF-like domains 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000018642   Gene: ENSPANG00000011718   Transcript: ENSPANT00000008559
Sequence length 808
Comment pep:known_by_projection chromosome:PapAnu2.0:3:113824837:113913279:-1 gene:ENSPANG00000011718 transcript:ENSPANT00000008559 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QGGEHCYYQGRIRGNPASFVALSTCHGLHGMFYDGNHTYLIEPEENDTTQEDFHFHSVYK
SRLFEFPLDDLPSEFQQVNITPPKFILKPRPKRSKRQLHRYPRNVEEETKYIELMIVNDH
LMFKKHRLSVVHTNTYAKSVVNMADIIYKDQLKTRIVLVAMETWATDNKFAISENPLITL
REFMKYRRDFIKEKSDAVHLFSGSQFESSRSGAAYIGGICSLLKGGGVNEFGKTDLMAVT
LAQSLAHNIGIISDKRKLASGECKCEDTWSGCIMGDTGYYLPKKFTQCNVEEYHDFLNSG
GGACLFNKPSKVISVANKKREYLKSSGFCCCCIYSLFSYEIHTSCGACTLNETSKEKSNF
CGSTQNFQPMGTVCREAVNDCDIRETCSGNSSQCAPNIHKMDGYSCDGVQGICFGGRCKT
RDRQCKYIWGQKVTASDKYCYEKLNIEGTEKGNCGKDKDTWIQCNKRDVLCGYLLCTNIG
NIPRLGELDGEITSTLVVQQGRTLNCSGGHVKLEEDVDLGYVEDGTPCGPQMMCLEHRCL
PVASFNFSTCLSSKEGTICSGNGVCSNELKCVCNRHWIGSDCNTYFPHNDDAKTGITLSG
NGVAGTNIIIGIIAGTILVLALILGITAWGYKKRNYREQRQLPQGDYVKKPGDGDSFYSD
IPPGVSTNSASSSKKRSAFLSHFQISTCSITHYSISQNISLFCSRSNGLSHSWSERIPDT
KHISDICENGRPRSNSWQGNLGGNKKKIRGKRFRPRSNSTETLSPAKSPSSSTGSIASSR
KYPYPMPPLPDEEKKVNRQSARLWETSI
Download sequence
Identical sequences ENSPANP00000018642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]