SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000018693 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000018693
Domain Number 1 Region: 190-531
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.78e-71
Family Protein kinases, catalytic subunit 0.00000318
Further Details:      
 
Domain Number 2 Region: 38-185
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 4.42e-34
Family Regulator of G-protein signaling, RGS 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000018693   Gene: ENSPANG00000009761   Transcript: ENSPANT00000018507
Sequence length 563
Comment pep:known_by_projection chromosome:PapAnu2.0:17:90364684:90379769:1 gene:ENSPANG00000009761 transcript:ENSPANT00000018507 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDFGSLETVVANSAFIAARGSFDGSSSQPSRDKKYLAKLKLPPLSKCEYLRDSLSLEFES
VCLEQPIGKKLFQQFLQSAEQHVPALELWKDIEDYDTADNDLQPQKAQTILAQYLDHHAK
LFCSFLDEGMVVKFKEGPMESQDGLFQPLLQATLAHLGQAPFQEYLGSLYFLRFLQWKWL
EAQPMGEDWFLDFRVLGKGGFGEVSACQMKATGKLYACKKLNKKRLKKRKGYQGAMVEKK
ILMKVHSRFIVSLAYAFETKADLCLVMTIMNGGDIRYHIYNVNEENPGFPEPRAVFYTAQ
IICGLEHLHQRRIVYRDLKPENVLLDNDGRRRPRRQGAAVMCMGLQGATKGGQGQAGFMA
PELLQGEEYDFSVDYFALGVTLYEMIAARGPFRARGEKVENKELKQRIVSEPVKYPDKFS
QASKDFCEALLEKDPEKRLGFRDETCDKLRTHFLFKDLNWRQLEAGMLIPPFIPDSKTVY
AKDIQDVGAFSTVKGVAFDKTDTEFFQEFATGNCPIPWQEEMIETGVFGELNVWRSDGQM
PDDMKGISGGSGSSSKSGMCLVS
Download sequence
Identical sequences ENSPANP00000018693

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]