SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000018694 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000018694
Domain Number 1 Region: 215-260
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000745
Family Laminin-type module 0.038
Further Details:      
 
Domain Number 2 Region: 282-340
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000126
Family Laminin-type module 0.024
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000018694
Domain Number - Region: 338-385
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000151
Family Laminin-type module 0.019
Further Details:      
 
Domain Number - Region: 390-418
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000251
Family EGF-type module 0.034
Further Details:      
 
Domain Number - Region: 39-95
Classification Level Classification E-value
Superfamily Sialidases 0.0177
Family Sialidases (neuraminidases) 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000018694   Gene: ENSPANG00000007561   Transcript: ENSPANT00000028592
Sequence length 457
Comment pep:known_by_projection chromosome:PapAnu2.0:1:108208750:108373697:1 gene:ENSPANG00000007561 transcript:ENSPANT00000028592 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GNPYMCNNECDASTPELAHPPELMFDFEGRHPSTFWQSATWKEYPKPLQVNITLSWSKTI
ELTDNIVITFESGRPDQMILEKSLDYGRTWQPYQYYATDCLDAFHMDPKSVKDLSQHTVL
EIICTEEYSTGYTTNSKIIHFEIKDRFAFFAGPRLRNMASLYGQLDTTKKLRDFFTVTDL
RIRLLRPAVGEIFVDELHLARYFYAISDIKVRGRCKCNLHATVCVYDNSKLTCECEHNTT
GPDCGKCKKNYQGRPWSPGSYLPIPKGTANTCIPSISSIGNCECFGHSNRCSYIDLLNTV
ICVSCKHNTRGQHCELCRLGYFRNASAQLDDENVCIECYCNPLGSIHDRCNGSGFCECKT
GTTGPKCDECLPGNSWHYGCQPNVCDNELLHCQNGGTCHNNVRCLCPAAYTGILCEKLRC
EEAGSCGSDSGQGAPPHGSPALLLLTTLLGSASPLVF
Download sequence
Identical sequences ENSPANP00000018694

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]