SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000018701 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000018701
Domain Number 1 Region: 257-626
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 1.44e-114
Family Oxysterol-binding protein 0.000029
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000018701
Domain Number - Region: 4-69
Classification Level Classification E-value
Superfamily PH domain-like 0.00129
Family Pleckstrin-homology domain (PH domain) 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000018701   Gene: ENSPANG00000011538   Transcript: ENSPANT00000014150
Sequence length 627
Comment pep:known_by_projection chromosome:PapAnu2.0:2:171921384:172242046:-1 gene:ENSPANG00000011538 transcript:ENSPANT00000014150 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLVVYSANGEMFKLRAADAKEKQFWVTQLRACAKYHMEMNSKSAPGSRSRSLTLLPHGTP
NSASPCSQRHLSVGAPGVVTITHHKSPAAARRAKSQYSGQLHEVREMMNQVEGQQKNLVH
AIESLPGSGPLTALDQDLLLLKATSAATLSCLGECLNLLQQSVHQAGQPSQKPGASENIL
GWHGPKSHSTEQLKNGTLGSLPSASANITWAILPNSTEDEQTSQPEPEPNSGSELVLSED
EKSDNEDKEETELGVMEDQRSIILHLISQLKLGMDLTKVVLPTFILEKRSLLEMYADFMA
HPDLLLAITAGATPEERVICFVEYYLTAFHEGRKGALAKKPYNPIIGETFHCSWEVPKDR
IKPKRTAPCSPAGCHEHPMADDPSKSYKLRFVAEQVSHHPPISCFYCECKEKRLCVNTHV
WTKSKFMGMSVGVSMIGEGVLRLLEHGEEYVFTLPSAYARSILTIPWVELGGKVSINCAK
TGYSATVIFHTKPFYGGKVHRVTAEVKHNPTNTIVCKAHGEWNGTLEFTYSNGETKVIDT
TTLPVYPKKIRPLEKQGPMESRNLWREVTRYLRLGDIDAATEQKRHLEEKQRVEERKREN
LRAPWKPKYFIQEGDGWVYFNPLWKAH
Download sequence
Identical sequences A0A2I3MM86
ENSPANP00000018701

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]