SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000018718 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000018718
Domain Number 1 Region: 270-382
Classification Level Classification E-value
Superfamily FKBP-like 7.27e-37
Family FKBP immunophilin/proline isomerase 0.00029
Further Details:      
 
Domain Number 2 Region: 378-482
Classification Level Classification E-value
Superfamily FKBP-like 1.83e-33
Family FKBP immunophilin/proline isomerase 0.00037
Further Details:      
 
Domain Number 3 Region: 42-124
Classification Level Classification E-value
Superfamily FKBP-like 1.34e-28
Family FKBP immunophilin/proline isomerase 0.00052
Further Details:      
 
Domain Number 4 Region: 171-268
Classification Level Classification E-value
Superfamily FKBP-like 8.05e-26
Family FKBP immunophilin/proline isomerase 0.00077
Further Details:      
 
Domain Number 5 Region: 487-563
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000502
Family Calbindin D9K 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000018718   Gene: ENSPANG00000015699   Transcript: ENSPANT00000011357
Sequence length 574
Comment pep:known_by_projection chromosome:PapAnu2.0:3:78076584:78124934:-1 gene:ENSPANG00000015699 transcript:ENSPANT00000011357 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
APMAFRGWRPPPPPLLLLLLWVTGQAAPVAGLGSDAELQIERRFVPDECPRTVRSGDFVR
YHYVGTFPDGQKFDSSYDRDSTFNVFVGKGQLITGMDQALVGMCVNERRFVKIPPKLAYG
SEGVCLFLLDVKESVINTDILNDTLNEKKTVFSLFFQFHVEPLFFRRLMHVLVHFYSFPT
EAGGSVFAFSHNRMKTYDTYVGIGWLIPGMDKGLLGMCVGEKRIITIPPFLAYGEDGDGK
DIPGQASLVFDVALLDLHNPKDSISIENKVVPENCERISQSGDFLRYHYNGTLLDGTLFD
SSYSRNRTFDTYIGQGYVIPGLDEGLLGVCIGEKRRIVVPPHLGYGEEGRGNIPGSAVLV
FDIHVIDFHNPSDSISITSHYKPPDCSVLSKKGDYLKYHYNASLLDGTLLDSTWNLGKTY
NIVLGSGQVVLGMDMGLREMCVGEKRTVIIPPHLGYGEAGVDGEVPGSAVLVFDIELLEL
VAGLPEGYMFIWNGEVSPNLFEEIDKDGNGEVLLEEFSEYIHAQVASGKGKLAPGFDAEL
VVKNMFTNQDRNGDGKVTAEEFKLKDQEAKHDEL
Download sequence
Identical sequences ENSPANP00000018718

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]