SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000018767 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000018767
Domain Number 1 Region: 360-724
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 1.83e-126
Family Hect, E3 ligase catalytic domain 0.00000000515
Further Details:      
 
Domain Number 2 Region: 13-138
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.12e-22
Family PLC-like (P variant) 0.034
Further Details:      
 
Domain Number 3 Region: 275-315
Classification Level Classification E-value
Superfamily WW domain 0.000000000000362
Family WW domain 0.00079
Further Details:      
 
Domain Number 4 Region: 231-269
Classification Level Classification E-value
Superfamily WW domain 0.00000000129
Family WW domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000018767   Gene: ENSPANG00000023126   Transcript: ENSPANT00000019076
Sequence length 731
Comment pep:known_by_projection chromosome:PapAnu2.0:3:40320500:40439632:-1 gene:ENSPANG00000023126 transcript:ENSPANT00000019076 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSNPGTRRNGSSIKIRLTVLCAKNLAKKDFFRLPDPFAKIVVDGSGQCHSTDTVKNTLDP
KWNQHYDLYVGKTDSITISVWNHKKIHKKQGAGFLGCVRLLSNAISRLKDTGYQRLDLCK
LNPSDTDAVRGQIVVSLQTRDRIGTGGSVVDCRGLLENEGSVYEDSGPGRPLSCFMEEPA
PYTDSTGAAAGGGNCRFVESPSQDQRLQAQRLRNPDVRGSLQTPQNRPHGHQSPELPEGY
EQRTTVQGQVYFLHTQTGVSTWHDPRIPRDLNSVNCDELGPLPPGWEVRSTVSGRIYFVD
HNNRTTQFTDPRLHHIMNHQCQLKEPSQPLPLPSEGSLEDEELPAQRYERDLVQKLKVLR
HELSLQQPQAGHCRIEVSREEIFEESYRQIMKMRPKDLKKRLMVKFRGEEGLDYGGVARE
WLYLLCHEMLNPYYGLFQYSTDNIYMLQINPDSSINPDHLSYFHFVGRIMGLAVFHGHYI
NGGFTVPFYKQLLGKPIQLSDLESVDPELHKSLVWILENDITPVLDHTFCVEHNAFGRIL
QHELKPNGRNVPVTEENKKEYVRLYVNWRFMRGIEAQFLALQKGFNELIPQHLLKPFDQK
ELELIIGGLDKIDLNDWKSNTRLKHCVADSNIVRWFWQAVETFDEERRARLLQFVTGSTR
VPLQGFKALQGSTGAAGPRLFTIHLIDANTDNLPKAHTCFNRIDIPPYESYEKLYEKLLT
AVEETCGFAVE
Download sequence
Identical sequences A0A096P092 A0A2K5V9I8 H9EPZ4
ENSPANP00000018767 XP_005549179.1.63531 XP_008016863.1.81039 XP_014989809.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]