SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000018784 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000018784
Domain Number 1 Region: 62-172
Classification Level Classification E-value
Superfamily GINS helical bundle-like 4.5e-37
Family PSF2 C-terminal domain-like 0.000000705
Further Details:      
 
Domain Number 2 Region: 1-60
Classification Level Classification E-value
Superfamily PriA/YqbF domain 8.5e-22
Family PSF2 N-terminal domain-like 0.0000599
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000018784   Gene: ENSPANG00000020355   Transcript: ENSPANT00000021302
Sequence length 185
Comment pep:known_by_projection chromosome:PapAnu2.0:20:67414674:67424748:-1 gene:ENSPANG00000020355 transcript:ENSPANT00000021302 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDAAEVEFLAEKELVTIIPNFSLDKIYLIGGDLGPFNPGLPVEVPLWLAINLKQRQKCRL
LPPEWMDVEKLEKMRDHERKEETFTPMPSPYYMELTKLLLNHASDNIPKADEIRTLVKDM
WDTRIAKLRVSADSFVRQQEAHAKLDNLTLMEINTSGTFLTQALNHMYKLRTNLQPSEST
QSQDF
Download sequence
Identical sequences A0A096P0A9 A0A0D9S205 A0A2K5J608 A0A2K5NXC7 A0A2K6LGA4 A0A2K6QXS2 H9ZA02
ENSPANP00000018784 XP_007992452.1.81039 XP_010353912.1.97406 XP_011783440.1.43180 XP_011934631.1.92194 XP_014984764.1.72884 XP_017716100.1.44346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]