SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000018813 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000018813
Domain Number 1 Region: 275-473
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.67e-26
Family Nucleotide and nucleoside kinases 0.00041
Further Details:      
 
Domain Number 2 Region: 59-249
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000000347
Family Nucleotide and nucleoside kinases 0.043
Further Details:      
 
Domain Number 3 Region: 397-425
Classification Level Classification E-value
Superfamily Microbial and mitochondrial ADK, insert "zinc finger" domain 0.0000000471
Family Microbial and mitochondrial ADK, insert "zinc finger" domain 0.0017
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000018813
Domain Number - Region: 13-52
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.000259
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000018813   Gene: ENSPANG00000026030   Transcript: ENSPANT00000028443
Sequence length 484
Comment pep:known_by_projection chromosome:PapAnu2.0:15:5053341:5212617:1 gene:ENSPANG00000026030 transcript:ENSPANT00000028443 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSASAPHRIPPEMPQYGEENHIFELMQNMLEQLLIHQPEDPIPFMIQHLHKDNDNVPRI
VILGPPASGKTTIAMWLCKHLNSSLLTLENLVLNEFSLTATKAKRLYLQRKTIPSALLVQ
LIQERLAEEDCVKRGWTRDNQENVPESSDYPCRAKKRLGIESHHSGVVLSAPDTVLIERN
LGKRIDPQTGEIYHTTFDWPPESEIQNRLMVPEDISELETAQKLLEYHRNIVRVIPSYPK
ILKVISADQPCVDVFYQALTYVQSNHRTNAPFTPRVLLLGPVGSGKSLQAALLAQKYRLV
NVCCGQLLKEAVADRTTFGELIQPFFEKEMAVPDSLLMKVLSQRLDQQDCIQKGWVLHGV
PRDLDQAHLLNSLGYNPNRVFFLNVPFDSIMERLTLRRIDPVTGERYHLMYKPPPTMEIQ
ARLLQNPKDAEEQVKLKMDLFYRNSADLEQLYGSAITLNGDQDPYTVFEYIESGIINPLP
KKIP
Download sequence
Identical sequences ENSPANP00000018813

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]