SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000018829 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000018829
Domain Number 1 Region: 32-114
Classification Level Classification E-value
Superfamily EF-hand 0.00000000397
Family Calmodulin-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000018829   Gene: ENSPANG00000025979   Transcript: ENSPANT00000028429
Sequence length 155
Comment pep:known_by_projection chromosome:PapAnu2.0:15:6870269:6895086:-1 gene:ENSPANG00000025979 transcript:ENSPANT00000028429 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGALSNRFQGGKAFGLLKARQERRLAEINREFLCDQKYSDEENLPEKLTAFKEKYMEFD
LNNEGEIADLMSLKRMMEKLGVPKTHLEMKKMISEVTGGVSDTISYRDFVNMMLGKRSAV
LKLLQTSVMMFEGKANESSPKPVGPPPERDIASLP
Download sequence
Identical sequences ENSPANP00000018829

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]