SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000018833 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000018833
Domain Number 1 Region: 168-291
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.43e-41
Family Eukaryotic type KH-domain (KH-domain type I) 0.000000256
Further Details:      
 
Domain Number 2 Region: 74-166
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.43e-26
Family Cold shock DNA-binding domain-like 0.00000497
Further Details:      
 
Domain Number 3 Region: 25-74
Classification Level Classification E-value
Superfamily Ribosomal L27 protein-like 0.00000000000549
Family ECR1 N-terminal domain-like 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000018833   Gene: ENSPANG00000025966   Transcript: ENSPANT00000028386
Sequence length 293
Comment pep:known_by_projection chromosome:PapAnu2.0:15:7258267:7269096:-1 gene:ENSPANG00000025966 transcript:ENSPANT00000028386 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAMEMRLPAARKPLSERLGRDTKKHLVVPGDTITTDTGFMRGHGTYMGEEKLIASVAGSV
ERVNKLICVKALKTRYIGEVGDIVVGRITEVQQKRWKVETNSRLDSVLLLSSMNLPGGEL
RRRSAEDELAMRGFLQEGDLISAEVQAVFSDGAVSLHTRSLKYGKLGQGVLVQVSPSLVK
RQKTHFHDLPCGASVILGNNGFIWIYPTPEHKEEEAGGFIANLEPVSLADREVISRLRNC
VISLVTQRMMLYDTSILYCYEASLPHQIKDILKPEIMEEIVMETRQRLLEQEG
Download sequence
Identical sequences A0A096P0F8 A0A0D9RQI8 A0A2K5JU12 A0A2K5L6A3 A0A2K5X8R0 A0A2K6AAA6 A0A2K6BW18 G7NFJ1
XP_005580681.1.63531 XP_008004110.1.81039 XP_011709962.1.29376 XP_011786587.1.43180 XP_011826538.1.47321 XP_011894202.1.92194 ENSPANP00000018833

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]