SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000018862 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000018862
Domain Number 1 Region: 94-144,230-316
Classification Level Classification E-value
Superfamily alpha/beta knot 6.8e-32
Family Hypothetical protein MTH1 (MT0001), dimerisation domain 0.0054
Further Details:      
 
Domain Number 2 Region: 128-211
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.11e-17
Family Hypothetical protein MTH1 (MT0001), insert domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000018862   Gene: ENSPANG00000025932   Transcript: ENSPANT00000028195
Sequence length 326
Comment pep:known_by_projection chromosome:PapAnu2.0:15:9209512:9213888:1 gene:ENSPANG00000025932 transcript:ENSPANT00000028195 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSRRSFGPTWPVRLPEPVPSSVWMRSWCLMRRARMPRPWRGNSQELGRRGRRAYSWPGS
CSTWSVRSKGVTPLSMRDGCVKVEAREEVASPGTILRSAFFPRYLRKAFFPKHQDLQFAG
LLNPLDSPHHMRQDEESEFREGIVVDRPTRPGHGSFVNCGMKKEVKIDKNLEPGLRVTVR
LNQQQLPECKTYRGKVVSSQDPRTKAGLYWGYTVRLASCLSAVFAEAPFQDGYDLTIGTS
ERGSDVASAHLPSFRHALVVFGGLQGLEAGVDADPNLEVAEPSVLFDLYVNTCPGQGSRT
IRTEEAILISLAALQPGLTQAGAQHP
Download sequence
Identical sequences ENSPANP00000018862

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]