SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000018878 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000018878
Domain Number 1 Region: 877-1024
Classification Level Classification E-value
Superfamily Spectrin repeat 5.89e-39
Family Spectrin repeat 0.00011
Further Details:      
 
Domain Number 2 Region: 339-493
Classification Level Classification E-value
Superfamily Spectrin repeat 3e-36
Family Spectrin repeat 0.00017
Further Details:      
 
Domain Number 3 Region: 1960-2115
Classification Level Classification E-value
Superfamily Spectrin repeat 9.29e-35
Family Spectrin repeat 0.00000193
Further Details:      
 
Domain Number 4 Region: 239-387
Classification Level Classification E-value
Superfamily Spectrin repeat 6.41e-34
Family Spectrin repeat 0.0005
Further Details:      
 
Domain Number 5 Region: 1532-1683
Classification Level Classification E-value
Superfamily Spectrin repeat 8.38e-34
Family Spectrin repeat 0.0000181
Further Details:      
 
Domain Number 6 Region: 657-809
Classification Level Classification E-value
Superfamily Spectrin repeat 9.55e-34
Family Spectrin repeat 0.0000536
Further Details:      
 
Domain Number 7 Region: 1867-2008
Classification Level Classification E-value
Superfamily Spectrin repeat 9.9e-34
Family Spectrin repeat 0.00000164
Further Details:      
 
Domain Number 8 Region: 1423-1565
Classification Level Classification E-value
Superfamily Spectrin repeat 6.02e-33
Family Spectrin repeat 0.00094
Further Details:      
 
Domain Number 9 Region: 552-705
Classification Level Classification E-value
Superfamily Spectrin repeat 4.32e-32
Family Spectrin repeat 0.00014
Further Details:      
 
Domain Number 10 Region: 146-281
Classification Level Classification E-value
Superfamily Spectrin repeat 7.13e-31
Family Spectrin repeat 0.0000125
Further Details:      
 
Domain Number 11 Region: 1635-1796
Classification Level Classification E-value
Superfamily Spectrin repeat 3.01e-29
Family Spectrin repeat 0.00042
Further Details:      
 
Domain Number 12 Region: 2065-2220
Classification Level Classification E-value
Superfamily Spectrin repeat 1.01e-28
Family Spectrin repeat 0.00094
Further Details:      
 
Domain Number 13 Region: 2227-2340
Classification Level Classification E-value
Superfamily Spectrin repeat 4.45e-26
Family Spectrin repeat 0.00029
Further Details:      
 
Domain Number 14 Region: 1799-1901
Classification Level Classification E-value
Superfamily Spectrin repeat 4.56e-24
Family Spectrin repeat 0.00000164
Further Details:      
 
Domain Number 15 Region: 2449-2606
Classification Level Classification E-value
Superfamily EF-hand 6.07e-24
Family Calmodulin-like 0.0041
Further Details:      
 
Domain Number 16 Region: 2342-2457
Classification Level Classification E-value
Superfamily Spectrin repeat 1.44e-20
Family Spectrin repeat 0.00079
Further Details:      
 
Domain Number 17 Region: 1102-1164
Classification Level Classification E-value
Superfamily SH3-domain 6.69e-20
Family SH3-domain 0.0000384
Further Details:      
 
Domain Number 18 Region: 1193-1300
Classification Level Classification E-value
Superfamily Spectrin repeat 2.2e-19
Family Spectrin repeat 0.0013
Further Details:      
 
Domain Number 19 Region: 1025-1096
Classification Level Classification E-value
Superfamily Spectrin repeat 3.74e-19
Family Spectrin repeat 0.001
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000018878
Domain Number - Region: 1344-1368
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0596
Family Spectrin repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000018878   Gene: ENSPANG00000025894   Transcript: ENSPANT00000027873
Sequence length 2613
Comment pep:known_by_projection chromosome:PapAnu2.0:15:9412691:9517936:-1 gene:ENSPANG00000025894 transcript:ENSPANT00000027873 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALEDYQRMLGYQVKDSKVEQQDNFLKRMSGMIRLYAAIIQLRWPYGNRQEIHPHGLNHG
WRWLAQILNMEPLSDVTATLLFDFLEVCGNALMKQYQVQFWKMLILIKEDYFPRIEAITS
SGQMGSFIRLKQFLEKMDPSGVKVLETAEDIQERRQQVLDRYHRFKELSTLRRQKLEDSY
RFQFFQRDAEELEKWIQEKLQIASDENYKDPTNLQGKLQKHQAFEAEVQANSGAIVKLDE
TGNLMISEGHFASETIRTRLMELHRQWELLLEKMREKGIKLLQAQKLVQYLRECEDVMDW
INDKEAIVTSEELGQDLEHVEVLQKKFEEFQTDMAAHEERVNEVNQFAAKLIQEQHPEEE
LIKTKQDEVNAAWQRLKGLALQRQGKLFGAAEVQRFNRDVDETISWIKEKEQLMASDDFG
RDLASVQALLRKHEGLERDLAALEDKVKALCAEADRLQQSHPLSATQIQVKREELITNWE
QIRTLAAERHARLNDSYRLQRFLADFRDLTSWVTEMKALINADELANDVAGAEALLDRHQ
EHKGEIDAHEDSFKSADESGQALLAAGHYASDEVREKLTVLSEERAALLELWELRRQQYE
QCMDLQLFYRDTEQVDNWMSKQEAFLLNEDLGDSLDSVEALLKKHEDFEKSLSAQEEKIT
ALDEFATKLIQNNHYAMEDVATRRDALLSRRNALHERAMRRRAQLADSFHLQQFFRDSDE
LKSWVNEKMKTATDEAYKDPSNLQGKVQKHQAFEAELSANQSRIDALEKAGQKLIDVNHY
AKDEVAARMNEVISLWKKLLEATELKGIKLREANQQQQFNRNVEDIELWLYEVEGHLASD
DYGKDLTNVQNLQKKHALLEADVAAHQDRIDGITIQARQFQDAGHFDAENIKKKQEALVA
RYEALKEPMVARKQKLADSLRLQQLFRDVEDEETWIREKEPIAASTNRGKDLIGVQNLLK
KHQALQAEIAGHEPRIKAVTQKGNAMVEEGHFAAEDVKAKLHELNQKWEALKAKASQRRQ
DLEDSLQAQQYFADANEAESWMREKEPIVGSTDYGKDEDSAEALLKKHEALMSDLSAYGS
SIQALREQAQSCRQQVAPMDDETGKELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDW
WKVEVNDRQGFVPAAYVKKLDPAQSASRENLLEEQGSIALRQEQIDNQTRITKEAGSVSL
RMKQVEELYHSLLELGEKRKGMLEKSCKKFMLFREANELQQWINEKEAALTSEEVGADLE
QVEVLQKKFDDFQKDLKANESRLKDINKVAEDLESEGLMAEEVQAVQQQEVYGMMPRDET
DPKTASPWKSARLMVHTVATFNSIKELNERWRSLQQLAEERSQLLGSAHEVQRFHRDADE
TKEWIEEKNQALNTDNYGHDLASVQALQRKHEGFERDLAALGDKVNSLGETAERLIQSHP
ESAEDLQEKCTELNQAWSSLGKRADQRKAKLGDSHDLQRFLSDFRDLMSWINGIRGLVSS
DELAKDVTGAEALLERHQEHRTEIDARAGTFQAFEQFGQQLLAHGHYASPEIKQKLDILD
QERADLEKAWVQRRMMLDQCLELQLFHRDCEQAENWMAAREAFLNTEDKGDSLDSVEALI
KKHEDFDKAINVQEEKIAALQAFADQLIAAGHYAKGDISSRRNEVLDRWRRLKAQMIEKR
SKLGESQTLQQFSRDVDEIEAWISEKLQTASDESYKDPTNIQLSKLLSKHQKHQAFEAEL
HANADRIRGVIDMGNSLIERGACAGSEDAVKARLAALADQWQFLVQKSAEKSQKLKEANK
QQNFNTGIKDFDFWLSEVEALLASEDYGKDLASVNNLLKKHQLLEADISAHEDRLKDLNS
QADSLMTSSAFDTSQVKDKRDTINGRFQKIKSMAASRRAKLNESHRLHQFFRDMDDEESW
IKEKKLLVGSEDYGRDLTGVQNLRKKHKRLEAELAAHEPAIQGVLDTGKKLSDDNTIGKE
EIQQRLAQFVEHWKELKQLASARGQRLEESLEYQQFVANVEEEEAWINEKMTLVASEDYG
DTLAAIQGLLKKHEAFETDFTVHKDRVNDVCTNGQDLIKKNNHHEENISSKMKGLNGKVS
DLEKAAAQRKAKLDENSAFLQFNWKADVVESWIGEKENSLKTDDYGRDLSSVQTLLTKQE
TFDAGLQAFQQEGIANITALKDQLLAAKHVQSKAIEARHASLMKRWSQLLANSATRKKKL
LEAQSHFRKVEDLFLTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIKALREAHDAFRSS
LSSAQADFNQLAELDRQIKSFRVASNPYTWFTMEALEETWRNLQKIIKERELELQKEQRR
QEENDKLRQEFAQHANAFHQWIQETRTYLLDGSCMVEESGTLESQLEATKRKHQEIRAMR
SQLKKIEDLGAAMEEALILDNKYTEHSTVGLAQQWDQLDQLGMRMQHNLEQQIQARNTTG
VTEEALKEFSMMFKHFDKDKSGRLNHQEFKSCLRSLGYDLPMVEEGEPDPEFEAILDTVD
PNRDGHVSLQEYMAFMISRETENVKSSEEIESAFRALSSEGKPYVTKEELYQNLTREQAD
YCVSHMKPYVDGKGRELPTAFDYVEFTRSLFVN
Download sequence
Identical sequences ENSPANP00000018878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]