SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000018905 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000018905
Domain Number 1 Region: 393-425
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000000968
Family CCCH zinc finger 0.0024
Further Details:      
 
Domain Number 2 Region: 7-50
Classification Level Classification E-value
Superfamily RING/U-box 0.00000906
Family RING finger domain, C3HC4 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000018905   Gene: ENSPANG00000025840   Transcript: ENSPANT00000027810
Sequence length 1175
Comment pep:known_by_projection chromosome:PapAnu2.0:15:11820993:11864218:1 gene:ENSPANG00000025840 transcript:ENSPANT00000027810 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVQAAQWTEFLSCPICYNEFDENVHKPISLCSHTVCKICLNKLHRKACPXFALLQLVGA
QVPDHQSIKLSNLGENKHYEVAKKCVEDLALYLKPLSGGKGVASLNQSALSRPMQRKLVT
LVNCQLVEEEGRVRAMRAARSLGERTVTELILQHQNPQQLSANLWAAVRARGCQFLGPAM
QEEALKLVLLALEDGSALSRKVLVLFVVQRLEPRFPQASKTSIGHVVQLLYRASCFKVTK
RDEDSSLMQLKEEFRSYEALRREHDAQIVHIAMEAGLRISPEQWSSLLYGDLAHKSHMQS
IIDKLQSPESFAKSVQELTIVLQRTGDPANLNRLRPHLELLANIDPNPDAVSPTWEQLEN
AMVAVKTVVHGLVDFIQNYSRKGHETPQPQPNSKYKTSMCRDLRQQGGCPRGTNCTFAHS
QEELEKYRLRNKKINATVRTFPLLNKVGVNNTVTTTAGNVISVIGSTETTGKIVPSTNGI
SNAENSVSQLISRSTDSTLRALETVKKVGKVGTNGQNAAGPSADSVTENKIGSPPKTPVS
NVAATSAGPSNVGTELNSVPQKSSPFLTRVPVYPPHSENIQYFQDPRTQIPFEVPQYPQT
GYYPPPPTVPAGVAPCVPRFVRSNNVPESSLPPASMPYADHYSTFSPRDRMNSSPYQPPP
PQPYGPVPPVPSGMYAPVYDSRRIWRPPMYQRDDIIRSNSLPPMDVMHSSVYQTSLRERY
NSLDGYYSVACQPPSEPRTTVPLPREPCGHLKTSCEEQIRRKPDQWAQYHTQKAPLVSST
LPVATQSPTPPSPLFSVDFRADFSESVSGTKFEEDHLSHYSPWSCGTIGSCINAIDSEPK
DVIANSNAVLMDLDSGDVKRRVHLFETQRRTKEEDPIIPFSDGPIISKWGAISRSSRTGY
HTTDPVQATASQGSATKPISVSDYVPYVNAVDSRWSSYGNEATSSAHYIERDRFIVTDLS
GHRKHSSTGDLLSLELQQAKSNSLLLQREANALAMQQKWNSLDEGRHLTLNLLSKEIELR
NGELQSDYTEDSTDTKPDRDIELELSALDTDEPDGQSEPIEEILDIQLGISSQNDQLLNG
TAVENGHPVQQHQKEPPKQKKQSLGEDHVILEEQKTILPVTSCFSQPLPVSVSNASCLPI
TTSVSVGNLILKTHVMSEDKNDFLKPVANGKMVNS
Download sequence
Identical sequences ENSPANP00000018905

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]