SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000018907 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000018907
Domain Number 1 Region: 73-581
Classification Level Classification E-value
Superfamily Heme-dependent peroxidases 6.36e-191
Family Myeloperoxidase-like 0.00000000000000561
Further Details:      
 
Domain Number 2 Region: 32-70
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000172
Family EGF-type module 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000018907   Gene: ENSPANG00000025843   Transcript: ENSPANT00000027731
Sequence length 599
Comment pep:known_by_projection chromosome:PapAnu2.0:15:12385328:12410563:-1 gene:ENSPANG00000025843 transcript:ENSPANT00000027731 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRSLLLQFLLLLLLLPQLPVLLADPGAPTPVNPCCYYPCQHQGICVRFGLDRYQCDCTR
TGYSGPNCTIPGLWTWLRNSLRPSPSFTHFLLTHGRWFWEFVNATFIRELLMRLVLTVRS
NLIPSPPTYNSAHDYISWESFSNVSYYTRILPSVPKDCPTPMGTKGKKQLPDAQLLARRF
LLRRKFIPDPQGTNLMFAFFAQHFTHQFFKTSGKMGPGFTKALGHGVDLGHIYGDNLERQ
YQLRLFKDGKLKYQVLDGEVYPPSVEEAPVLMHYPRGTPPQSQMAVGQEVFGLLPGLMLY
ATLWLREHNRVCDLLKAEHPTWGDEQLFQTTRLILIGETIRIVIEEYVQQLSGYFLQLKF
DPELLFGVQFQYRNRIAMEFNHLYHWHPLMPDSFKVGSQEYSYEQFLFNTSMLVDYGVEA
LVDAFSRQSAGRIGGGRNMDHHVLHVAVDVIRESREMRLQPFNEYRKRFGMKPYTSFQEL
VGEKEMAAELEELYGDIDALEFYPGLLLEKCHPNSIFGESMIEIGAPFSLKGLLGNPICS
PEYWKPSTFGGEMGFNIVKTATLKKLVCLNTKTCPYVSFRVPDASQDDGPAVERPSTEL
Download sequence
Identical sequences A0A096P0N2 A0A2K5WTB1
ENSMMUP00000016924 XP_001088270.1.72884 XP_005580931.1.63531 ENSPANP00000018907

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]