SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000018911 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000018911
Domain Number 1 Region: 239-298
Classification Level Classification E-value
Superfamily Homeodomain-like 8.98e-18
Family Homeodomain 0.0049
Further Details:      
 
Domain Number 2 Region: 126-192
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000159
Family LIM domain 0.023
Further Details:      
 
Domain Number 3 Region: 92-124
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000297
Family LIM domain 0.028
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000018911
Domain Number - Region: 186-219
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0769
Family LIM domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000018911   Gene: ENSPANG00000025837   Transcript: ENSPANT00000027754
Sequence length 303
Comment pep:known_by_projection chromosome:PapAnu2.0:15:12560931:12576025:1 gene:ENSPANG00000025837 transcript:ENSPANT00000027754 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYWKHENAAPALPEGCRLPAEGGPATDQVMAQPGSGCKATTRCLEGTAPPAMAQSDAEAL
AGALDKDEGRASPCTPSTPSVCSPPSAASSVPSAGKNICSSCGLEILDRYLLKVNNLIWH
VRCLECSVCRTSLRQQNSCYIKNKEIFCKMDYFSRFGTKCARCGRQIYASDWVRRARGNA
YHLACFACFSCKRQLSTGEEFGLVEEKVLCRIHYDTMIENLKRAAENGNGLTLEGAVPSE
QDSQPKPAKRARTSFTAEQLQVMQAQFAQDNNPDAQTLQKLADMTGLSRRVIQVWFQNCP
GAS
Download sequence
Identical sequences ENSPANP00000018911

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]