SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000018941 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000018941
Domain Number 1 Region: 918-966,997-1038
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000176
Family Fibronectin type III 0.0097
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000018941
Domain Number - Region: 506-553
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0212
Family Merozoite surface protein 1 (MSP-1) 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000018941   Gene: ENSPANG00000025801   Transcript: ENSPANT00000027656
Sequence length 1191
Comment pep:known_by_projection chromosome:PapAnu2.0:15:17433263:18420358:1 gene:ENSPANG00000025801 transcript:ENSPANT00000027656 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGTAADISLVHWRQQWLENGTLYFHVSMSSSGQLAQATAPTLQEPSEIVEEQMHILHIS
VMGGLIALLLLLLVFTVALYAQRRWQKRRRIPQKSASTEATHEIHYIPSVLLGPQARESF
RSSRLQTHNSVIGVPIRETPILDDYDCEEDEEPPRRANHVSREDEFGSQVTHTLDSLGRP
GEEKVDFEKKAAAEVTQETVESLMQKFKESFRANTPIEIGQLQPALRSTSAGKRKRRSKS
RGGISFGRAKGTSGSEADDETQLTFYTEQYRSRRRSKGLLKSPVNKTALTLIAVSSCILA
MVCGSQMSCPLTVKVTLHVPEHFIADGSSFVVSEGSYLDISDWLNPAKLSLYYQINATSP
WVRDLCGQRTTDACEQLCDPETGECSCYEGYAPDPVHRHLCVRSDWGQSEGPWPYTTLER
GYDLVTGEQAPEKILRSTFSLGQGLWLPVSKSFVVPPVELSINPLASCKTDVLVTEDPAD
VREEAMLSTYFETINDLLSSFGPVRDCSRNNGGCTRNFKCVSDRQVDSSGCVCPEELKPM
KDGSGCYDHSKGIDCSDGFNGGCEQLCLQQTLPLPYDATSSTIFMFCGCVEEYKLAPDGK
SCLMLSDVCEGPKCLKPDSKFNDTLFGEMLHGYNNRTQHVNQGQVFQMTFRENNFIKDFP
QLADGLLVIPLPVEEQCRGVLSEPLPDLQLLTGDIRYDEAMGYPMVQQWRVRSNLYRVKL
STITLSAGFTNVLKILTKESSREELLSFIQHYGSHYIAEALYGSELTCIIHFPSKKVQQQ
LWLQYQKETTELGSKKELKSMPFITYLSGLLTAQMLSDDQLISGVEIRCEEKGRCPSTCH
LCRRPGKEQLSPTPVLLEINRVVPLYTLIQDNGTKEAFKSALMSSYWCSGKGDVIDDWCR
CDLSAFDASGLPNCSPLPQPVLRLSPTVEPSSTVVSLEWVDVQPAIGTKVSDYILQHKKV
DEYTDTDLYTGEFLSFADDLLSGLGTSCVAAGRSHGEVPEVSIYSVIFKCLEPDGLYKFT
LYAVDTRGRHSELSTVTLRTACPLVDDNKAEEIADKIYNLYNGYTSGKEQQMAYNTLMEV
SASMLFRVQHHYNSHYEKFGDFVWRSEDELGPRKAHLILRRLERVSSHCSSLLRSAYIQS
RVETVPYLFCRSEEVRPAGMVWYSILKDTKITCEEKMVSMARNTYGESKGR
Download sequence
Identical sequences ENSPANP00000018941

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]