SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000018943 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000018943
Domain Number 1 Region: 158-278,343-410
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.00000000000000249
Family Reprolysin-like 0.067
Further Details:      
 
Domain Number 2 Region: 289-451
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.0000000000173
Family Reprolysin-like 0.05
Further Details:      
 
Domain Number 3 Region: 1203-1266
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000208
Family Complement control module/SCR domain 0.0049
Further Details:      
 
Domain Number 4 Region: 1139-1211
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000431
Family Complement control module/SCR domain 0.0026
Further Details:      
 
Domain Number 5 Region: 1077-1143
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000987
Family Complement control module/SCR domain 0.0037
Further Details:      
 
Domain Number 6 Region: 1-66
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000194
Family Clostridium neurotoxins, the second last domain 0.07
Further Details:      
 
Domain Number 7 Region: 1008-1081
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000222
Family Complement control module/SCR domain 0.0039
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000018943
Domain Number - Region: 464-500,679-733
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00172
Family Fibronectin type III 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000018943   Gene: ENSPANG00000025803   Transcript: ENSPANT00000027624
Sequence length 1420
Comment pep:known_by_projection chromosome:PapAnu2.0:15:18450303:18695149:-1 gene:ENSPANG00000025803 transcript:ENSPANT00000027624 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLYVNGAQVATSGEQVGGIFSPLTQKCKVLMLGGSALNHNYRGYIEHFSLWKVARTQRE
ILSDMETHGTHTALPQLLLQENWDNVKHAWSPMKDGSSPKVEFSNAHGFLLDTSLEPPLC
GQTLCDNAEVIASYNQLPSFRQPKVVRYRVVNLYEDDHKNPMVTREQVDFQHQQLAEAFK
HYNISWELKVLEVSNSSLRRRLILANCDISKIGDENCDPECNHTLTGHDGGDCRHLRHPA
FMKKQQNGVCDMDCNYERFNFDGGECCDPKITDVTQTCFDPDSPHRAYLDVNELKNILRL
DGSTHLNIFFANSSEEELAGVATWPWDKEALMHLGGIVLNPSFYGMPGHTHTMIHEIGHS
LGLYHVFRGISEIQSCSDPCMETEPSFETGDLCNDTNPAPKHKSCGDPGPGNDTCGFHSF
FNTPYNNFMSYADDDCTDSFTPNQVARMHCYLDLVYQSWQPSRKPAPVALAPQVVGHTTD
SVTLEWFPPIDGHFFERELGSACDLCLEGRILVQYAFNASSPMPCSPSGHWSPREAEGHP
DVEQPCKSSVRTWSPNSAVNPHTVPPACPEPQGCYLELEFLYPLVPESLTIWVTFVSTDW
DSSGAVNDIKLLTVSGKNISLGPQNVFCDIPLTIRLRDVGEEVYGIQIYTLDEHLEIDAA
MLTSTADTPLCLQCKPLQYKVVRDPPLQVDVASILHLNRKFIDMDLNRSSVYQYWVITIS
GTEESEPSPAVTYIHGSGYCGDGIIQKDQGEECDDLNKINGDGCSLFCRQEVSFNCIDEP
SRCYFHDGDGVCEEFEQKTSIKDCGVYTPQGFLDQWASNASVSHQDQQCPGWVIIGQPAA
SQVCRTKVIDLSEGISQHAWYPCTISYPYSQLAQTTFWLRAYFSQPMVAAAVIVHLVTDG
TYYGDQKQETISVQLLDTKDQSHDLGLHVLSCRNNPLIIPVVHDLSQPFYHSQAVRVSFS
SPLVAISGVALRSFDNFDPVTLSSCQRGETYSPAEQSCVHFACENTDCPELAVENASLNC
SSSDRYHGAQCTVSCRTGYVLQIRRDDELIKSQMGPSVTVTCTEGKWNKQVACEPVDCSI
PDHHHVYAASFSCPDGTTFGSQCSFQCRHPAQLKGNNSLLTCMEDGLWSFPEALCELMCL
APPPVPNADLQTPRCRENKHKVGSFCKYKCKPGYHVPGSSRKSKKRAFKTQCTQDGSWQE
GACVPVTCDPPPPKFHGLYQCTNGFQFNSECRIKCEDSDASQGRGSNIIHCRKDGTWSGS
FHVCQEMQGQCSVPNQLNSNLKLQCPDGYAIGSECATSCLDHNSESIILPMNVTVRDIPY
WLNPTRVERVVCTAGLKWYPHPALIHCVKGCEPFMGDNYCDAINNRAFCNYDGGDCCTST
VKTKKVTPFPMSCDLQGDCACRDPQAQEHSRKDLRGYSHG
Download sequence
Identical sequences ENSPANP00000018943

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]