SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000018944 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000018944
Domain Number 1 Region: 1971-2194
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 3.53e-80
Family Fibrinogen C-terminal domain-like 0.00000198
Further Details:      
 
Domain Number 2 Region: 894-1063
Classification Level Classification E-value
Superfamily Fibronectin type III 6.52e-22
Family Fibronectin type III 0.00034
Further Details:      
 
Domain Number 3 Region: 1801-1965
Classification Level Classification E-value
Superfamily Fibronectin type III 6.13e-21
Family Fibronectin type III 0.00067
Further Details:      
 
Domain Number 4 Region: 1708-1797
Classification Level Classification E-value
Superfamily Fibronectin type III 8.32e-20
Family Fibronectin type III 0.0000194
Further Details:      
 
Domain Number 5 Region: 624-786
Classification Level Classification E-value
Superfamily Fibronectin type III 1.66e-17
Family Fibronectin type III 0.0012
Further Details:      
 
Domain Number 6 Region: 1260-1344
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000289
Family Fibronectin type III 0.0012
Further Details:      
 
Domain Number 7 Region: 801-891
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000804
Family Fibronectin type III 0.000003
Further Details:      
 
Domain Number 8 Region: 1621-1708
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000014
Family Fibronectin type III 0.0016
Further Details:      
 
Domain Number 9 Region: 1078-1162
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000216
Family Fibronectin type III 0.0021
Further Details:      
 
Domain Number 10 Region: 1169-1253
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000526
Family Fibronectin type III 0.0026
Further Details:      
 
Domain Number 11 Region: 1530-1617
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000713
Family Fibronectin type III 0.0027
Further Details:      
 
Domain Number 12 Region: 1348-1435
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000917
Family Fibronectin type III 0.0025
Further Details:      
 
Domain Number 13 Region: 1441-1526
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000225
Family Fibronectin type III 0.0024
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000018944
Domain Number - Region: 412-435
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000201
Family Integrin beta EGF-like domains 0.057
Further Details:      
 
Domain Number - Region: 505-528
Classification Level Classification E-value
Superfamily EGF/Laminin 0.001
Family EGF-type module 0.047
Further Details:      
 
Domain Number - Region: 474-497
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00167
Family EGF-type module 0.049
Further Details:      
 
Domain Number - Region: 536-560
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0026
Family EGF-type module 0.08
Further Details:      
 
Domain Number - Region: 598-621
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00486
Family EGF-type module 0.054
Further Details:      
 
Domain Number - Region: 287-311
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00662
Family EGF-type module 0.027
Further Details:      
 
Domain Number - Region: 258-281
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00762
Family EGF-type module 0.032
Further Details:      
 
Domain Number - Region: 194-217
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00762
Family EGF-type module 0.088
Further Details:      
 
Domain Number - Region: 319-342
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0142
Family EGF-type module 0.037
Further Details:      
 
Domain Number - Region: 381-404
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0151
Family EGF-type module 0.037
Further Details:      
 
Domain Number - Region: 348-373
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0159
Family EGF-type module 0.049
Further Details:      
 
Domain Number - Region: 443-466
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0209
Family EGF-type module 0.038
Further Details:      
 
Domain Number - Region: 225-249
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0243
Family EGF-type module 0.023
Further Details:      
 
Domain Number - Region: 567-590
Classification Level Classification E-value
Superfamily EGF/Laminin 0.036
Family EGF-type module 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000018944   Gene: ENSPANG00000025804   Transcript: ENSPANT00000027625
Sequence length 2201
Comment pep:known_by_projection chromosome:PapAnu2.0:15:19675216:19748964:1 gene:ENSPANG00000025804 transcript:ENSPANT00000027625 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAMTRLWAGVLLALLALLTEGGVLKKVIRHKRQSGVNITLPEENQPVVFNHVYNIKLPV
GSQCSVDLESASGEKDLAPPSEPSESFQEHTVDGENQIVFTHRINIPRRACGCAAAPDVK
ELLSRLEELENLVSSLREQCAAGAGCCLQSAIGRVDTRPFCSGRGNFSTEGCGCVCEPGW
KGPNCSEPECPGNCNLRGQCIDGQCICDEGFTGEDCSQLACPGDCNDQGKCVNGVCICFE
GYAGADCSQEICPVPCSEEHGTCVDGLCVCHDGFAGDDCNKPLCLNNCYNRGRCVENECV
CDEGFTGEDCSELICPNDCFDRGRCINGTCYCEEGFTGEDCGKLTCPHACHGQGRCEEGQ
CVCDEGFAGVDCSEKRCPADCHNRGRCVDGQCECDDGFTGADCGELKCPNGCSGHGRCVN
GQCVCDEGYTGEDCSQLRCPNDCHSRGRCVQGKCVCEQGFKGYDCSDMSCPNDCHQHGRC
VNGMCVCDDGYTGEDCRDRQCPRDCSNRGRCVDGQCICEDGFTGPDCAELSCPNDCHGRG
RCVNGQCVCHEGFMGKDCKEQRCPSDCHGQGRCMDGQCICHEGFTGLDCGQRSCPSDCSN
LGQCVSGRCICNEGYAGEDCSEVSPPKDLIVTEVTEETVNLAWDNEMRVTEYLVVYTPTH
EGGLEMQFRVPGDQTSTIIRELEPGVEYFIRVFAILENKKSIPVSARVATYLPAPEGLKF
KSIKETSVEVEWDPLDIAFETWEIIFRNMNKEDEGEITKSLRRPETSYRQTGLAPGQEYE
ISLHIVKNNTRGPGLKRVTTTRLDAPSQMEVKDVTDTTALITWFKPLAEIDGIELTYGIK
DVPGDRTTIDLTEDENQYSIGNLKPDTEYEVSLISRRGDMSSNPAKETFTTGLDAPRNLR
RVSQTDNSITLEWRNGKAAIDSYRIKYAPISGGDHAEVDVPKSQQATTKTTLTGLRPGTE
YGIGVSAVKEDKESNPATINAATELDTPKDLRVSETAETSLTLFWKTPLAKFDRYRLNYS
LPTGQWVGVQLPRNTTSYVLRGLEPGQEYNVLLTAEKGRHKSKPARVKASTEQAPELENL
TVTEVGWDGLRLNWTAADQAYEHFVIQVQEANKVEAAQNLTVPGNLRAVDIPGLKAATPY
TVSIYGVIQGYRTPVLSAEASTGETPNLGEVMVAEVGWDALKLNWTVPEGAYEYFFIQVQ
EADTVEAAQNHTVPGGLRSTDLPGLKAATRYTITIRGVTQDFSTTPLSVEVLTEEVPDMG
NLTVTEVSWDALRLNWTTPDGTYDQFTIQVQEADQVEEAHNLTVPGSLRSVEIPGLRAGT
PYTITLHGEVRGHSTRPLALEVITEELPQLGDLAVSEVGWDGLRLNWTAADQAYEHFVIQ
VQEVNKVEAAQNLTVPGSLRAVDIPGLKAAMPYTVSIYGVIRGYRTPVLSAEASTAKEPE
IGNLNVSDITPESFSLSWTATDGIFETFTIEIIDSNRLLEIVEYNISGAERTAHISGLPP
STDFIVYLSGLAPSIRTKTISATATTEALPLLENLTISDINPYGFTVSWMASENAFDSFL
VTVVDSGKLLDPQEFTLSGTQRKLELRGLITGIGYEVMVSGFTQGHQTKPLRAEIVTEAE
PEVDNLLVSDATPDGFRLSWTADEGVFDNFVLKIRDTKKQSEPLEITLLAPERTRDITGL
REATEYEIELYGISKGKRSQPVSAIATTAMGSPREVIFSDITENSATVSWRAPTAQVESF
RITYVPITGGTPSMVTVDGTKTQTRLVKLVPGVEYLVNIIAMKGFEESEPVSGSFTTALD
GPSGLVTANITDSEALARWQPAIATVDSYVISYTGEKVPEITRTVSGNTVEYALTDLEPA
TEYTLRIFAEKGPQKSSTVTAKFTTDLDSPRDLTATEVQSETALLTWRPPRASVTGYLLV
YESVDGTVKEVIVGPDTTSYSLVDLSPSSHYTAKIQALNGPLRSNMIQTIFTTIGLLYPF
PKDCSQAMLNGDTTSGLYTIYLNGDKAQALEVFCDMTSDGGGWIVFLRRKNGHENFYQNW
KAYAAGFGDRREEFWLGLDNLNKITAQGQYELRVDLRDHGETAFAVYDKFSVGDAKTRYK
LKVEGYSGTAGDSMAYHNGRSFSTFDKDTDSAITNCALSYKGAFWYRNCHRVNLMGRYGD
NNHSQGVNWFHWKGHEHSIQFAEMKLRPSNFRNLEGRRKRA
Download sequence
Identical sequences A0A096P0R9
ENSPANP00000018944

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]