SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000018951 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000018951
Domain Number 1 Region: 23-320,424-464
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.54e-67
Family FAD-linked reductases, N-terminal domain 0.0000000000642
Further Details:      
 
Domain Number 2 Region: 300-410
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 2.22e-36
Family L-aminoacid/polyamine oxidase 0.000000731
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000018951   Gene: ENSPANG00000025805   Transcript: ENSPANT00000027606
Sequence length 530
Comment pep:known_by_projection scaffold:PapAnu2.0:JH685061.1:120681:200353:-1 gene:ENSPANG00000025805 transcript:ENSPANT00000027606 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HEELVWHPCKIFDPDVLLSFLPGMAAAKLLHDSGLNVVVLEARDRVGGRTYTLRGKQNQK
VKYVDLGGSYVGPTQNRILRLAKELGLETYKVNEVERLIHHVKGKSYPFRGPFPPVWNPI
TYLDHNNFWRTMDDMGREIPSDAPWKAPLAEEWDNMTMKELLDKVCWTESAKQLGTLFVN
LCVTAETHEVSALWFLWYVKQCGGTTRIISTTNGGQERKFVGGSGQVSERIMDLLGDRVK
LERPVIYIDQTRENVLVQTLNHEMYEAKYVISAIPPTLGMKIHFNPPLPMMRNQMITRVP
LGSVIKCIVYYKEPFWRKKDYCGTMIIDGEEAPVAYTLDDTKPEGNYAAIMGFILAHKAR
KLARLTKEERLKKLCELYAKVLGSPEALEPVHYEEKNWCEEQYSGGCYTTYFPPGILTQY
GRVLRQPVDRIYFAGTETATHWSGYMEGAVEAGERAAREILHAMGKIPEDEVWQSEPESV
DVPALPITTTFLERYLPSVPGLLRLIGLTTIFSATALGFLAHKRGLLMRV
Download sequence
Identical sequences ENSPANP00000018951

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]