SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000018959 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000018959
Domain Number 1 Region: 949-1079
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.15e-45
Family Regulator of G-protein signaling, RGS 0.00000618
Further Details:      
 
Domain Number 2 Region: 26-149
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 4.46e-22
Family Synaptotagmin-like (S variant) 0.00093
Further Details:      
 
Domain Number 3 Region: 182-262
Classification Level Classification E-value
Superfamily PDZ domain-like 3.59e-17
Family PDZ domain 0.0000166
Further Details:      
 
Domain Number 4 Region: 440-543
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000787
Family Pleckstrin-homology domain (PH domain) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000018959   Gene: ENSPANG00000025790   Transcript: ENSPANT00000027614
Sequence length 1085
Comment pep:known_by_projection chromosome:PapAnu2.0:15:21183742:21316447:-1 gene:ENSPANG00000025790 transcript:ENSPANT00000027614 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERSLHRVSLGSRRAHPDLSFYLTTFGQLRLSIDAQDRVLLLHIIEGKGLISKQPGACDP
YVKISLIPEDNRLHHQKTQTVPDCRDPAFHEHFFFPVQEEDDQKRLLVTVWNRASQSRQS
GLIGCMSFGVKSLLTPEKEISGWYYLLGEHLGRTKHLKVARRRLRPLRDPLLRMPGGGDA
ENGKKLKITIPRGKDGFGFTICCDSPVRVQAVDSGGPAERAGLQQLDTVLQLNERPVEHW
KCVELAHEIRSCPSEIILLVWRMVPQVKPGPDGGVLRRASCKSTHDLQSPPNKREKNCTH
GAQARPEQRHSCHLVCDSSDGLLLGGWERYTEVAKRGGQHTLPALSRATAPTDPNYIILA
PLNPGSQLLRPVYQEDTIPEESGSPSKGKSYTGLGKKSRLMKTVQTMKGHGNYQNCPVVR
PHATHSSYGTYVTLAPKVLVFPVFVQPLDLCNPARTLLLSEELLLYEGRNKAAQVTLFAY
SDLLLFTKEDEPGRCDVLRNPLYLQSVKLQEGSSEDLKFCVLYLAEKAECLFTLEAHSQE
QKKRVCWCLSENIAKQQQLAASPPDSKMFETEADEKTEMSLEEGKGPGAEDSPPSKEPSP
GQELPPGQDLLPNKDSPSGQEPASSQEPLSSKDSATCEESPPGPDAPPSKDAPPCQESPP
AQDLSPCQDLPAGQEPLPHQDPLLTKDLPAVQEPPTQDLPPCQDLPPSQVSLSAKALTEG
TMSSGDPLATTGDQPAASRPAFVIPEVRLDSTYSQKAGAERGCSGDEEEEEAEEGEEGEE
GEEDEDEDTSDDNYGERSEAKRSSMIETGQGAEGGLSLRVQNSLRRRTHSEGSLLQEPRG
PCFASDTTLHCSDGEGAASTWGMPSPSTLKKELGRNGGSMHHLSLFFTGHRKMSGADTVG
DDDEASRKRKSKNLAKDMKNKLGIFRRRNESPGAPPAGKADKMMKSFKPTSEEALKWGES
LEKLLVHKYGLAVFQAFLRTEFSEENLEFWLACEDFKKVKSQSKMASKAKKIFAEYIAIQ
ACKEVNLDSYTREHTKDNLQSVTRGCFDLAQKRIFGLMEKDSYPRFLRSDLYLDLINQKK
MSPPL
Download sequence
Identical sequences ENSPANP00000018959

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]