SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000018963 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000018963
Domain Number 1 Region: 147-313
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.9e-40
Family SPRY domain 0.0003
Further Details:      
 
Domain Number 2 Region: 12-71
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000198
Family B-box zinc-binding domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000018963   Gene: ENSPANG00000025778   Transcript: ENSPANT00000027618
Sequence length 319
Comment pep:known_by_projection chromosome:PapAnu2.0:15:21401925:21423607:-1 gene:ENSPANG00000025778 transcript:ENSPANT00000027618 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAEGAEPGPEPGPLCPEHGQALSWFCRSERRPVCAACAGLGGRCRGHRIRRAEERAEEL
RNKIVDQCERLQLQSAAITKYVADVLPGKNQRAVQKEQEIFERTEEAEGILDPQESEMLN
FNEKCTRSPLLTRLWATAVLGSLSGTEDIRIDERTVSPFLQLSDDRKTLTFSTKKSKTCA
DGPERFDHWPNALAATSFQNGLHAWMVNVQNSCAYKVGVASGHLPRKGSGSDCRLGHNAF
SWVFSRYDQEFRFSYNGQHEPLGLLRGPAQLGVLLDLQARELLFYEPASGTVLYTHHGSF
PGPLFPVFAVADQTISIVR
Download sequence
Identical sequences ENSPANP00000018963

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]