SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000018968 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000018968
Domain Number 1 Region: 36-188
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000000114
Family Tetratricopeptide repeat (TPR) 0.0094
Further Details:      
 
Domain Number 2 Region: 616-652,1044-1154
Classification Level Classification E-value
Superfamily TPR-like 0.000000111
Family Tetratricopeptide repeat (TPR) 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000018968   Gene: ENSPANG00000025781   Transcript: ENSPANT00000027565
Sequence length 2218
Comment pep:known_by_projection scaffold:PapAnu2.0:JH685262.1:8643:158410:1 gene:ENSPANG00000025781 transcript:ENSPANT00000027565 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIRIAALNASSTIEDDHEGSFKSHKTQTKEAQEAEAFALYHKALDLQKHDRFEESAKAYH
ELLEARLLREAVSSGDEKEGLKHPGLILKYSTYKNLAQLAAQREDLETAMEFYLEAVMLD
STDVNLWYKIGHVALRLIRIPLARHAFEEGLRCNPDHWPCLDNLITVLYTLSDYTTCLYF
ICKALEKDCRYSKGLVLKEKIFEEQPCLRKDSLRMFLKCDMSIHDVSVSAAETKAIVDEA
LGLRKKRQALIVREKEPDLKLVQPIPFLTWKCLGESLLAMYNHLTTCEPPRPSLGKRIDL
SDYQDPSQPLASSVVVTPVNEIQPSTVSTSPAVAVAEPVVSYTSVATTSFPLHSPGLLET
GAPMGDISGGDKSKKGVKRKKISEESGETAKRRSARVRNTKCKKEEKVDFQELLMKFLPS
RLRKLDPEEEDDSFNNYEVQSEAKLESFPSIGPHRLSFDSATFMESEKQDVHEFLLENLT
NGGILELMMRYLKGMGHKFLLRWPPGLAEVVLSVYHSWRRHSTSLPNPLLRDCSNKHIKD
MMLMSLSCMELQLDQWLLTKGRSSAVSPRNCPAGMVNGRFGPDFPGTHCLGDLLQLSFAS
SQRDLFEDGWLEFVVRVYWLKARFLALQGDMEQALENYDICTEMLQSSTAIQVEAGAGRR
DIVIRLPNLHNDSVVSLEEIDKNLKSLERCQSLEEIQRLYEAGDYKAVVHLLRPTLCTSG
FDRAKHLEFMTSIPERPAQLLLLQDSLLRLKDYRQCFECSDVALNEAVQQMVNSSEAAAK
EEWVATVTQLLMGIEQALSADSSGSILKESSSTTGLVRLTNNLIQVIDCSMAVQEEAKEP
HVSSVLPWIILHRIIWQEEDTFHSLCHQQQLQNPAEEGMSETPMLPSSLMLLNTAHEYLG
RRSWCCNSDGALLRFYVRVLQKELAASTSEDTHPYKEELETALEQCFYCLYSFPSKKSKA
RYLEEHSVQQVDLIWEDALFMFEYFKPKTLPEFDSYKTSTVSADLANLLKRIATIVPRTE
RPALSLDKVSAYIEGTSTEVPCLPEGADPSPPVVNELYYLLADYHFKNKEQSKAIKFYMH
DICICPNRFDSWAGMALARASRIQDKLNSNELKSDGPIWKHATPVLNCFRRALEIDSSNL
SLWIEYGTMSYALHSFASRQLKQWRGELPPEVVQQMEGRRDSMLETAKHCFTSAARCEGD
GDEEEWLIHYMLGKVAEKQQQPPTVYLLHYRQAGHYLHEEAARYPKKIHYHNPPELAMEA
LEVYFRLHASILKLLGKPDSGVGAEVLVNFMKEAAEGPFARGEEKNTPKASEKEKACLVD
EDSHSSAGTLPGPGASLPSSSGPGLTSPPYTATPIDHDYVKCKKPHQQATPDDRSQDSTA
VALSDSSSTQDFFNEPTSLLEGSRKAYTEKRLPVLSSQAGGTGKDLQGATEERGKNEEPL
ESTEGFRAAEQGVQKPVAEPPASACIPGKPSASIPTLWDGKKRGDLPGEPVAFPQGLPAG
AEEQRQFLTEQCIASFRLCLSRFPQHYKSLYRLAFLYTYSKTHRNLQWARDVLLGSSIPW
QQLQHMPAQGLFCERNKTNFFNGIWRIPVDEIDRPGSFAWHMNRSIVLLLKVLAQLRDHS
TLLKVSSMLQRTPDQGKKYLRDADRQVLAQRAFILTVKVLEDTLSELAEGSERPGPKVCG
LPGARMTTDVSHKASPEDGQEGLPQPKKPPLADGSGPGPEPGGKVGLLNHRPVAMDAGDS
ADQSGEWKDKETPRAGPTEPMDTSEATIRHSDLERTPPLLPGRPPRDRGPESRPTELSLE
ELSISARQQPTPLTSAQPAPAPATTIGTRAGGHPEEPLPRLSRKRKLLEDTESGKTLLLD
AYRVWQQGQKGVAYDLGRVERIMSETYMLIKQVDEEAALEQAVKFCQVHLGAAAQRQASG
DTPTTPKHPKDSRENFFPVTVAPTAPDPVPADSAQRPSDAHTKPRPAVAAATTVITCPPS
ASASTLDPSKDPGPPRPHRPEATPSMASLGPEGEELARVAEGTGFPPQEPRRSAQVKTAP
TSSPAEPHCWPAEAAPGTGTEPTCSQEGKLRPEPRREGEAQEAASETQPLSSPPTAASSK
APSGGSAQPPEGHPGKAEPSRAKSRPLPNMPKLVIPSAATKFPPEITVTPPTPTLLSPKG
SISEETKQKLKSAILSAQSAANVRKESLCQPALEVLETSSQESSLESETDEDDDYMDI
Download sequence
Identical sequences A0A096P0U3
ENSPANP00000018968

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]