SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000018975 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000018975
Domain Number 1 Region: 46-165
Classification Level Classification E-value
Superfamily PX domain 1.05e-31
Family PX domain 0.00064
Further Details:      
 
Domain Number 2 Region: 221-392
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0000000000565
Family IMD domain 0.094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000018975   Gene: ENSPANG00000025767   Transcript: ENSPANT00000027398
Sequence length 395
Comment pep:known_by_projection chromosome:PapAnu2.0:15:21847972:21916367:-1 gene:ENSPANG00000025767 transcript:ENSPANT00000027398 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLCVFSFNFKDLILPNGGTPAGTSSPASSSSLLNRLQLDDDIDGETRDLFVIVDDPKKHV
CTMETYITYRITTKSTRVEFDLPEYSVRRRYQDFDWLRSKLEESQPTHLIPPLPEKFVVK
GVVDRFSEEFVETRRKALDKFLKRITDHPVLSFNEHFNVFLTAKDLNAYKKQGIALLTRM
GESVKHVTGGYKLRTRPLEFAAIGDYLDTFALKLGTIDRIAQRIIKEEIEYLVELREYGP
VYSTWSALEGELAEPLEGVSACIGNCSTALEELTDDMTEDFLPVLREYILYSDSMKSVLK
KRDQVQAEYEAKLEAVALRKEDRPKVPADVEKCQDRMECFNADLKADMERWQNNKRQDFR
QLLMGMADKNIQYYEKCLMAWESIIPLLQEKQEAK
Download sequence
Identical sequences ENSPANP00000018975

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]