SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000018982 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000018982
Domain Number 1 Region: 132-211,238-269,708-774
Classification Level Classification E-value
Superfamily TPR-like 0.0000000759
Family Tetratricopeptide repeat (TPR) 0.018
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000018982
Domain Number - Region: 432-537
Classification Level Classification E-value
Superfamily TPR-like 0.0493
Family Tetratricopeptide repeat (TPR) 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000018982   Gene: ENSPANG00000025762   Transcript: ENSPANT00000027373
Sequence length 885
Comment pep:novel scaffold:PapAnu2.0:JH686039.1:39828:53191:1 gene:ENSPANG00000025762 transcript:ENSPANT00000027373 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DSVEEAETEQPQEREIPPPCLGPESQETLQKMKNVLEKCNKDLPRLPPASRNVSLQDPEE
LSFCLEAEDDWEDPEALSSLLLFLNAPGYKASDVALPWLSSVFCSFSDEELTGRLAQARG
VAKKAGLVTALARLCFLLGRLRSRRLKLSQAWVYFEEAPGALEGSFGDLLLVVAVYTNLA
SIYWKQKNREKCTQVVPKAVALLLGTPGHICSTEVEGELQLALRRAVGGQSLQAEARACF
LLARHHVHLKKPEEALPFLEWLLLFHRDSGAPEAAWLDCHLLLADICSCKCLPHLVLSCV
KVASLRARDSLAGSLRSVNLVLQNVLQPHSPHYLRRALASLTPGTGQVLRGLLHASLAQL
YSHHGYHGPAITFMTQAVEASAVARVRAIVDRLVAVAWLHVLQGQSPVALHILQSVQDAV
VASEDQEGVNANMVAVALKRTGRTRQAAEGYYRTLRVAWDLDQRRNQAVVLANFRALCLH
AGASRLAQHYLLEAMRLFLRLPCRECGRDLTHVLLQLGHLCTYQGPAQQGKGYYEWAHLV
AVEMGHVENGCPGSSCAPSGATRVRAHLEFAIQTQVVFLPLKGQALCARMGALVLTSVSD
SRAYKSSLDYTKRSLGIFIDLQKKEAAHAWLQAGKIYYILYIQLFIHRAQNVALYTGDPN
LGLELFEAAGDTFFNGTWEREKAVSFYWDRALLLAVTTGNRKAELRLCKLVALLATLEEP
QEGLEFAHMALALNITLGDRLNECVAYHRLAALHQQLGDGKLAEHFYLKALSLCNSPLEF
DEETLYYLKVYLVHSDIIYDLKDPFDAAGYYQALAATMDLGNKKAQLKIYTRLATIYQNF
LLDREKLLFYQKARTFTTELNVRRVHLPPLPLCGWAPWLAPRSPR
Download sequence
Identical sequences ENSPANP00000018982

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]