SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000018999 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000018999
Domain Number 1 Region: 642-916
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.18e-98
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000684
Further Details:      
 
Domain Number 2 Region: 228-374
Classification Level Classification E-value
Superfamily PH domain-like 7.38e-36
Family Third domain of FERM 0.00016
Further Details:      
 
Domain Number 3 Region: 125-230
Classification Level Classification E-value
Superfamily Second domain of FERM 7.85e-33
Family Second domain of FERM 0.00019
Further Details:      
 
Domain Number 4 Region: 521-610
Classification Level Classification E-value
Superfamily PDZ domain-like 6.84e-20
Family PDZ domain 0.0000991
Further Details:      
 
Domain Number 5 Region: 40-125
Classification Level Classification E-value
Superfamily Ubiquitin-like 9.09e-20
Family First domain of FERM 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000018999   Gene: ENSPANG00000025736   Transcript: ENSPANT00000027294
Sequence length 926
Comment pep:known_by_projection chromosome:PapAnu2.0:15:25341917:25426576:1 gene:ENSPANG00000025736 transcript:ENSPANT00000027294 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGISYVTGYSAIVMTSRLRALGGRINNIRTSELPKEKTRSEVICSIYFLDGVVQTFKVTK
QDTGQVLLDMAYNHLGVTEKEYFGLQHDDDSVDSPRWLEASKPIRKQLKGGFPCTLHFRV
RFFIPDPNTLQQEQTRHLYFLQLKMDICEGRLTCPLNSAVVLASYAVQSHFGDYNSSVHH
PGYLSDSQFIPDQNDDFLTKVESLHEQHSGLKQSEAESCYINIARTLDFYGVELHSGRDL
HNLDLMIGIASAGIAVYRKYICTSFYPWVNILKISFKRKKFFIHQRQKQAESREHIVAFN
MLNYRSCKNLWKSCVEHHTFFQAKKLLPQEKNVLSQYWTMGSRNTKKSVNNQYCKKVIGG
MVWNPAMRRSLSVEHLETKSLPSRSPPITPNWRSPRLRHEIRKPRHSSADNLANEMTYIT
ETEDVFYTYKGSLAPQDSDSEVSQNRSLHQESLSENNPAQSYRTQKSSSSVSPSSNAPGS
CSPDGVDQQFLDDFHRVTKGGSTEDTSQYYCDKNDNGDGYLVLIRITPDEDGKFGFNLKG
GVDQKMPLVVSRINPESPADTCIPKLNEGDQIVLINGRDISEHTHDQVVMFIKASRESHS
RELALVIRRRAVRSFADFKSEDELNQLFPEAIFPMCPEGGDTLEGSMAQLKKGLESGTVL
IQFEQLYRKKPGLAITFAKLPQNLDKNRYKDVLPYDTTRVLLKGNEDYINASYVNMEIPA
ANLVNKYIAAQGPLPHTCAQFWQVVWDQKLSLIVMLTTLTERGRTKCHQYWPDPPDVMDY
GSFHIQCQSEDCTIAYVSREMLVTNTQTGEEHTVTHLQYVAWPDHGVPDDSSDFLEFVNY
VRSLRVDSEPVLVHCSAGIGRTGVLVTMETAMCLTERNLPVYPLDIVRKMRDQRAMMVQT
SSQYKFVCEAILRVYEEGLVQMLDPS
Download sequence
Identical sequences ENSPANP00000018999

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]