SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000019033 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPANP00000019033
Domain Number - Region: 33-130
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0659
Family BAR domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000019033   Gene: ENSPANG00000025679   Transcript: ENSPANT00000027113
Sequence length 362
Comment pep:known_by_projection chromosome:PapAnu2.0:15:34209413:34217997:-1 gene:ENSPANG00000025679 transcript:ENSPANT00000027113 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEHNGSASNADKIHQNRLSSVTEDEDAALTIVTVLDKVASIVDSVQASQKRIEERHREME
NAIKSVQIDLLKLSQSHSNTGHIINKLFEKTRKVSAHIKDVKARVEKQQIHVKKVEVKQE
EIMKKNKFRVVIFQEKFRCPTSLSVVKDRNLTENQEEEEDDVFDPPIDLSSDEEYYVEES
RSARLRKSGKERIDNIKKAFSKENMQKTRQNLDKKVNRIRTRIVTPERRERLRQSGERLR
QSGERLRQSGERFKKSISNAAPSKEAFKMRSLRKGKDRTVAEGEECAREMGVDIIARSES
LGPISELYSDELSEPEHEAARPVYPAHEEREIPTPEPVKVTFKSQVKVEDDESLLLDLKH
SS
Download sequence
Identical sequences A0A096P108
ENSPANP00000019033

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]