SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000019034 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000019034
Domain Number 1 Region: 72-137
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 8.32e-16
Family Ovomucoid domain III-like 0.0046
Further Details:      
 
Domain Number 2 Region: 264-309
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000629
Family EGF-type module 0.0057
Further Details:      
 
Domain Number 3 Region: 172-229
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000374
Family Ovomucoid domain III-like 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000019034   Gene: ENSPANG00000025680   Transcript: ENSPANT00000027114
Sequence length 376
Comment pep:known_by_projection chromosome:PapAnu2.0:15:34219547:34320018:-1 gene:ENSPANG00000025680 transcript:ENSPANT00000027114 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAAAAEAPLRLPAAPPLAFCCYTSVLLLFAFSLPGSRASNQPPGGDCPGGKGKSINCSE
LNVRESDVRVCDESSCKYGGVCKEDGDGLKCACQFQCHTNYIPVCGSNGDTYQNECFLRR
AACKHQKEITVVARGPCYSDNGSGSGEGEEEGSGAEVHRKHSKCGPCKYKAECDEDAENV
GCVCNIDCSGYSFNPVCASDGSSYNNPCFVREASCIKQEQIDIRHLGHCTDTDDNSLLGK
KDDGLQYRPDVKDANDQREDVYIGNHMPCPENLNGYCIHGKCEFIYSTQKASCRCESGYT
GQHCEKTDFSILYVVPSRQKLTHVLIAAIIGAVQIAIIVAIVMCITSNRKCPKNNRGRRQ
KQNLGHFTSDTSSRMV
Download sequence
Identical sequences ENSPANP00000019034

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]