SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000019060 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000019060
Domain Number 1 Region: 134-207
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 2.75e-27
Family DNA repair factor XPA DNA- and RPA-binding domain, C-terminal subdomain 0.00000772
Further Details:      
 
Domain Number 2 Region: 98-132
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000143
Family DNA repair factor XPA DNA- and RPA-binding domain, N-terminal subdomain 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000019060   Gene: ENSPANG00000025590   Transcript: ENSPANT00000026993
Sequence length 273
Comment pep:known_by_projection chromosome:PapAnu2.0:15:37094232:37116683:1 gene:ENSPANG00000025590 transcript:ENSPANT00000026993 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAADGASPEAAALEQPAELPASVRASVERKRQRALMLRQARLAARPYPATAAAATGGMA
NVKAAPKIIDTGGGFILEEEEEEEHKIGKVVHQPGPVMEFDYVICEECGKEFMDSYLMNH
FDLPTCDNCRDADDKHKLITKTEAKQEYLLKDCDLEKREPPLKFIVKKNPHHSQWGDMKL
YLKLQIVKRSLEVWGSQEALEEAKEVRQENREKMKQKKFDKKVKELRRAVRSSVWKRETI
VHQHEYGPEENLEDDMYRKTCTVCGHELTYEKM
Download sequence
Identical sequences A0A096P135
ENSPANP00000019060

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]