SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000019069 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000019069
Domain Number 1 Region: 253-375
Classification Level Classification E-value
Superfamily SH2 domain 4.44e-28
Family SH2 domain 0.00084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000019069   Gene: ENSPANG00000025567   Transcript: ENSPANT00000027014
Sequence length 380
Comment pep:novel chromosome:PapAnu2.0:15:37906090:38053733:1 gene:ENSPANG00000025567 transcript:ENSPANT00000027014 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ASSASGAAGCCCASSGAGAAASSSSSSGSPHLYRSSSERRPATPAEVRYISPKHRLIKVE
SAAGGGAGDPLGSACAGGRTWSPTACGGKKLLNKCAASAAEESGAGKKDKVTIADDYSDP
FDAKNDLKSKAGKGESAGYMEPYEAQRIMTEFQRQESVRSQHKGIQLYDTPYEPEGQSVD
SDSESTVSPRLRESKLPQDDDRPADEYDQPWEWNRVTIPALAAQFNGNEKRQSSPSPSRD
RRRQLRAPGGGFKPIKHGSPEFCGILGERVDPAVPLEKQIWYHGAISRGDAENLLRLCKE
CSYLVRNSQTSKHDYSLSLRSNQGFMHMKLAKTKEKYILGQNSPPFDSVPEVIHYYTTRK
LPIKGAEHLSLLYPVAVRTL
Download sequence
Identical sequences ENSPANP00000019069

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]