SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000019118 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000019118
Domain Number 1 Region: 213-281,346-430,531-571
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000548
Family Tetratricopeptide repeat (TPR) 0.047
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000019118
Domain Number - Region: 97-168
Classification Level Classification E-value
Superfamily Histidine-containing phosphotransfer domain, HPT domain 0.00491
Family Chemotaxis protein CheA P1 domain 0.06
Further Details:      
 
Domain Number - Region: 459-562
Classification Level Classification E-value
Superfamily TPR-like 0.0284
Family Tetratricopeptide repeat (TPR) 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000019118   Gene: ENSPANG00000025328   Transcript: ENSPANT00000026617
Sequence length 622
Comment pep:known_by_projection chromosome:PapAnu2.0:15:40968790:40974555:1 gene:ENSPANG00000025328 transcript:ENSPANT00000026617 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRQTTSVGSSCLDLWREKNDRLVRQAKVAQNSGLTLRRQQLAQDALEGLRGLLHSLQGL
PAAVPVLPLELTVICNFIILRASLAQGFTEDQAQDIQRGLERVLETQEQRGPRLEQGLRE
LWDSALRASCLLPELLSALHRLAGLQAALWLSADRLGDLALLLETLNDSQSGASEDLLLL
LKTWSPPAEELDAPLTLQDAQGLKDVLLTAFAYRRGLQELITGNPEKALSSLHEVASGLC
PRPVLVQVYTALGSCHRKMGNPQRALLYLVAALKEGSAWGPPLLEASRLYQQLGDTTAEL
ESLELLVEALNVPYSSKAPPFLIEVELLLPPPDLASPLHCGTQSQAKHVLASRCLQMGRA
EDAAEHYLDLLALLLDSSEPRFSPPPSPPGPCMPEVFLEAAVALIQAGRAQDALTLCEEL
LRRTSSLLPKMSRLWENARKGTKELPYCPLWVSATHLLQGQAWVQLGAQKVAISEFSRCL
ELLFRTTPEEKEQGAASNGEQGCKSDVALQQLRAAALISRGLEWVASGQDTKALQDFLLG
VQMCPGNRDTYFHLLQTLKRLDRRDEATALWWRLEAQTKGPQEDATWSLPLYLESYLSWI
RPSDRDAFLEEFRTSLPKSCDL
Download sequence
Identical sequences A0A096P193
ENSPANP00000019118

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]