SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000019220 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000019220
Domain Number 1 Region: 63-331
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 7.96e-40
Family PhyH-like 0.065
Further Details:      
 
Domain Number 2 Region: 913-969
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 9.03e-22
Family Tudor domain 0.00037
Further Details:      
 
Domain Number 3 Region: 970-1025
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 7.52e-16
Family Tudor domain 0.00019
Further Details:      
 
Domain Number 4 Region: 712-750
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000465
Family PHD domain 0.016
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000019220
Domain Number - Region: 809-853
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0202
Family PHD domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000019220   Gene: ENSPANG00000025200   Transcript: ENSPANT00000025635
Sequence length 1090
Comment pep:novel chromosome:PapAnu2.0:15:67930709:68321047:-1 gene:ENSPANG00000025200 transcript:ENSPANT00000025635 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVADAESPLNPSCKIMTFRPSMEEFREFNKYLAYMESKGAHRAGLAKVIPPKEWKPRQC
YDDIDNLLIPAPIQQMVTGQSGLFTQYNIQKKAMTVKEFRQLANSGKYCTPRYLDYEDLE
RKYWKNLTFVAPIYGADINGSIYDEGVDEWNIARLNTVLDVVEEECGISIEGVNTPYLYF
GMWKTTFAWHTEDMDLYSINYLHFGEPKSWYAIPPEHGKRLERLAQGFFPSSSQGCDAFL
RHKMTLISPSVLKKYGIPFDKITQEAGEFMITFPYGYHAGFNHGFNCAESTNFATVRWID
YGKVAKLCTCRKDMVKISMDIFVRKFQPDRYQLWKQGKDIYTIDHTKPTPASTPEVKAWL
QRRRKVRKASRSFQCARSTSKRPKAEEEEEVSAEVDGAEVPNPDSGTDDLKVSEKSEAAA
KLRNTEAASEEESSASRMQVDQNLSDHIKLSGNSCLSTSVTEDIKTEDDKAYAYRSVPSI
LSEADDSIPLSSGYEKPEKSDPPKFSWPKSPQSCSSVSESNDVLTEEEESDVESHGNGLE
PGEIPAVPSGERNGFKVPSITEGENKTSKSWRHPLSRPPARSPMTLVKQQAPSDEELPEV
LSIEEEVEETESWAKPLIHLWQTKSPNFAAEQEYNATVARMKPHCAICTLLMPYHKPDSS
NEENDARWETKLDEVITLEGKTKPLIPEMCFIYSEENIEYSPPNAFLEEDGTSLLISCAK
CCVRVHASCYGIPSHEICDGWLCARCKRNAWTAECCLCNLRGGALKQTKNNKWAHVMCAV
AVPEVRFTNVPERTQIDVGRIPLQRLKLKCIFCRHRVKRVSGACIQCSYGRCPASFHVTC
AHAAGVLMEPDDWPYVVNITCFRHKVNPNVFTAQSKHSKNESCIATTTSTAAAAGATILC
ELGHKPKACEKVISVGQTVITKHRNTRYYSCRVMAVTSQTFYEVMFDDGSFSRDTFPEDI
VSRDCLKLGPPAEGEVVQVKWPDGKLYGAKYFGSNIAHMYQVEFEDGSQIAMKREDIYTL
DEELPKRVKARFSTASDMRFEDTFYGADIIQGERKRQRVLSSRFKNEYVADPVYRTFLKS
SFQKKCQKRQ
Download sequence
Identical sequences ENSPANP00000019220

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]