SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000019244 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000019244
Domain Number 1 Region: 844-1122
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.89e-71
Family Protein kinases, catalytic subunit 0.00000428
Further Details:      
 
Domain Number 2 Region: 522-816
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.79e-49
Family Protein kinases, catalytic subunit 0.0000815
Further Details:      
 
Domain Number 3 Region: 396-501,538-563
Classification Level Classification E-value
Superfamily SH2 domain 5.83e-19
Family SH2 domain 0.0032
Further Details:      
 
Domain Number 4 Region: 279-386
Classification Level Classification E-value
Superfamily PH domain-like 6.02e-16
Family Third domain of FERM 0.016
Further Details:      
 
Domain Number 5 Region: 141-261
Classification Level Classification E-value
Superfamily Second domain of FERM 0.000000267
Family Second domain of FERM 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000019244   Gene: ENSPANG00000025145   Transcript: ENSPANT00000025586
Sequence length 1135
Comment pep:known_by_projection chromosome:PapAnu2.0:15:70063315:70224778:-1 gene:ENSPANG00000025145 transcript:ENSPANT00000025586 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGMACLTMTEMEGTSTSSIYQNGDISGNANSMKQIDPVLQVYLYHSLGKSEADYLTFPSG
EYVAEEICIAASKACGITPVYHNMFALMSETERIWYPPNHVFHIDESTRHNVLYRIRFYF
PRWYCSGSNRAYRHGISRGAEAPLLDDFVMSYLFAQWRHDFVHGWIKVPVTHETQEECLG
MAVLDMMRIAKENDQTPLAIYNSISYKTFLPKCIRAKIQDYHILTRKRIRYRFRRFIQQF
SQCKATARNLKLKYLINLETLQSAFYTEKFEVKEPGSGPSGEEIFATIIITGNGGIQWSR
GKHKESETLTEQDLQLYCDFPNIIDVSIKQANQEGSDESRVVTIHKQDGKNLEIELSSLR
EALSFVSLIDGYYRLTADAHHYLCKEVAPPTVLENIQSNCHGPISMDFAISKLKKAGNQT
GLYVLRCSPKDFNKYFLTFAVERENVIEYKHCLITKNENEEYNLSGTKKNFSSLKDLLNC
YQMETVRSDNIIFQFTKCCPPKPKDKSNLLVFRTNGVSDVPTSPTLQRPTHMNQMVFHKI
RNEDLIFNESLGQGTFTKIFKGIRREVGDYGQLHETEVLLKVLDKAHRNYSEREFSEEAA
SMMSKLSHKHLVLNYGVCVCGEENILVQEFVKFGSLDTYLKKNKNCINILWKLEVAKQLA
WAMHFLEENTLIHGNVCAKNILLIREEDRKTGNPPFIKLSDPGISITVLPKDILQERIPW
VPPECIENPKNLNLATDKWSFGTTLWEICSGGDKPLSALDSQRKLQFYEDRHQLPAPKWA
ELANLINNCMDYEPDFRPSFRAVIRDLNSLFTPDYELLTENDMLPNMRIGALGFSGAFED
RDPTQFEERHLKFLQQLGKGNFGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFERE
IEILKSLQHDNIVKYKGVCYSAEGRRNLKLIMEYLPYGSLRDYLQKHKERIDHKKLLQYT
SQICKGMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEYYKVKEPGESP
IFWYAPESLTESKFSVASDVWSFGVVLYELFTYIEKSKSPPAEFMRMIGNDKQGQMIVFH
LIELLKNNGRLPRPDGCPDEIYMIMTECWNNNVNLRPSFRDLALRVDQIRDNMAG
Download sequence
Identical sequences ENSPANP00000019244

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]